Project name: r1_w

Status: done

submitted: 2018-11-07 11:40:23, status changed: 2018-11-07 11:48:52
Settings
Chain sequence(s) A: TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.1716
Maximal score value
0.708
Average score
-0.7338
Total score value
-57.2341

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
103 T A -0.5551
104 S A -0.0599
105 D A -0.1857
106 L A 0.0000
107 I A 0.0000
108 V A 0.0000
109 L A -0.1246
110 G A 0.0480
111 L A 0.0000
112 P A 0.0000
113 W A -1.2505
114 K A -2.1579
115 T A 0.0000
116 T A -2.0316
117 E A -2.5106
118 Q A -2.9705
119 D A -3.1716
120 L A 0.0000
121 K A -2.7007
122 E A -2.9152
123 Y A -1.5176
124 F A 0.0000
125 S A -1.2330
126 T A -0.6533
127 F A -0.7821
128 G A -1.1664
129 E A -1.9281
130 V A -0.7349
131 L A 0.7080
132 M A 0.2637
133 V A -0.6338
134 Q A -0.8564
135 V A 0.0000
136 K A 0.0000
137 K A -1.3473
138 D A -0.9540
139 L A 0.1868
140 K A -1.3140
141 T A -0.8977
142 G A -0.8891
143 H A -1.3626
144 S A 0.0000
145 K A -1.5234
146 G A 0.0000
147 F A 0.0000
148 G A 0.0000
149 F A 0.0000
150 V A 0.0000
151 R A -0.6417
152 F A 0.0000
153 T A -1.0973
154 E A -1.9078
155 Y A -0.5548
156 E A -1.6558
157 T A -1.2391
158 Q A 0.0000
159 V A -0.0116
160 K A -0.7909
161 V A 0.0000
162 M A -0.4390
163 S A -0.9642
164 Q A -1.6239
165 R A -1.9885
166 H A 0.0000
167 M A -0.1506
168 I A 0.0000
169 D A -2.1998
170 G A -1.2064
171 R A -0.7984
172 W A 0.2084
173 C A 0.0000
174 D A -0.8466
175 C A 0.0000
176 K A -0.6380
177 L A 0.6716
178 P A -0.2933
179 N A -1.1818
180 S A -0.6635

 

Laboratory of Theory of Biopolymers 2015