Project name: SH3_S94G

Status: done

submitted: 2019-03-14 15:15:29, status changed: 2019-03-14 16:07:28
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues SA94G
Energy difference between WT (input) and mutated protein (by FoldX) 0.585395 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4854
Maximal score value
1.2501
Average score
-0.9358
Total score value
-56.1496

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8541
92 Y A -2.1219
93 E A -2.9111
94 G A -2.2254 mutated: SA94G
95 R A -2.8122
96 T A -2.1754
97 E A -2.3658
98 T A -1.2569
99 D A -1.3552
100 L A 0.0000
101 S A -1.9321
102 F A 0.0000
103 K A -3.4854
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4375
111 V A 1.2501
112 N A -0.4196
113 N A -1.8139
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6842
118 W A -1.3436
119 W A -0.6987
120 L A 0.4033
121 A A 0.0000
122 H A -0.3837
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8788
127 G A -0.8169
128 Q A -1.4147
129 T A -0.4984
130 G A 0.0000
131 Y A 0.2084
132 I A 0.0000
133 P A 0.0000
134 S A -1.2853
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015