Project name: SH3_I110D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110D
Energy difference between WT (input) and mutated protein (by FoldX)	4.25043 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.9156
• Average score: -0.9412
• Total score value: -56.474

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5741
82	S	A	-0.8018
83	H	A	-0.8324
84	M	A	0.0122
85	T	A	0.0000
86	F	A	0.0000
87	V	A	-0.7219
88	A	A	0.0000
89	L	A	-0.3370
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3228
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.2161
108	L	A	0.0000
109	Q	A	-0.7368
110	D	A	-0.3921	mutated: IA110D
111	V	A	0.9156
112	N	A	-0.4885
113	N	A	-1.6484
114	T	A	-1.5583
115	E	A	-2.8157
116	G	A	-2.5214
117	D	A	-2.6321
118	W	A	-1.2702
119	W	A	-0.7571
120	L	A	0.2595
121	A	A	0.0000
122	H	A	-0.5971
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5842
130	G	A	0.0000
131	Y	A	0.1592
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3277
135	N	A	-1.2478
136	Y	A	-0.2255
137	V	A	0.0000
138	A	A	-0.0881
139	P	A	-0.3457
140	S	A	-0.2673