Project name: SH3_K103L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	KA103L
Energy difference between WT (input) and mutated protein (by FoldX)	0.580832 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -2.9363
• Maximal score value: 1.2498
• Average score: -0.6527
• Total score value: -39.161

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0573
87	V	A	-0.1775
88	A	A	0.0000
89	L	A	0.6579
90	Y	A	0.4299
91	D	A	-0.9612
92	Y	A	-1.0522
93	E	A	-2.2968
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1541
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3230
100	L	A	0.0000
101	S	A	-1.1691
102	F	A	0.0000
103	L	A	-0.0078	mutated: KA103L
104	K	A	-0.9964
105	G	A	-0.9747
106	E	A	0.0000
107	R	A	-1.7190
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3867
123	S	A	0.0000
124	L	A	-0.2877
125	T	A	-0.4273
126	T	A	-0.5389
127	G	A	-0.8239
128	Q	A	-1.4163
129	T	A	-0.4961
130	G	A	0.0000
131	Y	A	0.2196
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.1959
136	Y	A	-0.0257
137	V	A	0.0000
138	A	A	0.0608
139	P	A	-0.1505
140	S	A	-0.1759