Project name: 3de6158ac2961cf [mutate: PA112H, DA169G, NA267S]

Status: done

submitted: 2018-11-07 11:09:34, status changed: 2018-11-07 11:22:17
Settings
Chain sequence(s) A: KTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues PA112H, DA169G, NA267S
Energy difference between WT (input) and mutated protein (by FoldX) 2.25128 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.6808
Maximal score value
0.6776
Average score
-1.1863
Total score value
-199.2967

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
102 K A -2.6849
103 T A -1.7729
104 S A 0.0000
105 D A 0.0000
106 L A 0.0000
107 I A 0.0070
108 V A 0.0000
109 L A -0.0486
110 G A -0.4588
111 L A 0.0000
112 H A -1.4054 mutated: PA112H
113 W A -0.9286
114 K A -1.8262
115 T A -1.6048
116 T A -1.4285
117 E A -1.9592
118 Q A -2.4990
119 D A -2.4390
120 L A 0.0000
121 K A -2.2792
122 E A -2.7384
123 Y A -1.1903
124 F A 0.0000
125 S A -1.1465
126 T A -0.6118
127 F A -0.5098
128 G A -1.2867
129 E A -1.8207
130 V A 0.0000
131 L A 0.6776
132 M A 0.0000
133 V A 0.0000
134 Q A 0.0000
135 V A -0.6016
136 K A -1.3466
137 K A -2.1129
138 D A -1.5147
139 L A -0.3357
140 K A -1.4190
141 T A -1.3354
142 G A -1.3580
143 H A -2.0442
144 S A -1.8785
145 K A -2.3902
146 G A 0.0000
147 F A 0.0000
148 G A 0.0000
149 F A 0.1462
150 V A 0.0000
151 R A -0.1431
152 F A 0.0000
153 T A -1.1887
154 E A -2.4317
155 Y A -1.7093
156 E A -2.1689
157 T A 0.0000
158 Q A 0.0000
159 V A -0.7175
160 K A -1.0849
161 V A 0.0000
162 M A -0.8521
163 S A -1.2248
164 Q A -2.2013
165 R A -2.2907
166 H A 0.0000
167 M A -0.0883
168 I A 0.0000
169 G A -1.2563 mutated: DA169G
170 G A -0.9996
171 R A -1.1315
172 W A -0.2336
173 C A 0.0000
174 D A -1.1720
175 C A 0.0000
176 K A -1.0028
177 L A -0.4787
178 P A -0.9225
179 N A -1.6206
180 S A -1.2748
181 K A -1.6146
182 Q A -2.2765
183 S A -2.0845
184 Q A -3.0714
185 D A -3.5682
186 E A -2.8367
187 P A -1.4335
188 L A -0.4245
189 R A -2.6586
190 S A -3.1637
191 R A -3.0998
192 K A -2.4958
193 V A 0.0000
194 F A -0.0773
195 V A 0.0000
196 G A 0.0000
197 R A -1.2689
198 C A 0.0000
199 T A -1.6950
200 E A -2.6863
201 D A -2.9879
202 M A 0.0000
203 T A -1.8890
204 E A -1.9714
205 D A -3.2244
206 E A -3.0082
207 L A 0.0000
208 R A -3.0247
209 E A -3.2673
210 F A -1.8738
211 F A 0.0000
212 S A -1.6295
213 Q A -1.6888
214 Y A -0.4529
215 G A -1.2934
216 D A -1.9581
217 V A 0.0000
218 M A -0.7898
219 D A -1.8131
220 V A -1.0553
221 F A 0.3122
222 I A 0.0000
223 P A -0.8231
224 K A -1.8953
225 P A -1.6455
226 F A -1.3327
227 R A -1.8669
228 A A -0.8600
229 F A -0.0001
230 A A 0.0000
231 F A 0.2377
232 V A 0.0000
233 T A -1.3036
234 F A 0.0000
235 A A -1.6271
236 D A -2.5432
237 D A -3.6808
238 Q A -2.9785
239 I A -1.9657
240 A A 0.0000
241 Q A -2.3529
242 S A -1.4152
243 L A 0.0000
244 C A 0.0000
245 G A -1.9417
246 E A -2.1152
247 D A 0.0000
248 L A 0.0000
249 I A -0.1098
250 I A 0.0000
251 K A -1.9439
252 G A -0.7533
253 I A -0.6418
254 S A 0.0000
255 V A 0.0000
256 H A -0.6872
257 I A 0.0000
258 S A -0.7112
259 N A -1.3873
260 A A 0.0000
261 E A -2.8633
262 P A -2.8247
263 K A -3.2189
264 H A -2.7061
265 N A -2.9793
266 S A -2.3600
267 S A -2.2969 mutated: NA267S
268 R A -2.8817
269 Q A -2.4118

 

Laboratory of Theory of Biopolymers 2015