Project name: TDP43 [mutate: AA315A]

Chain sequence(s)	A: MNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
Distance of aggregation	5 Å
Dynamic mode	No
Mutated residues	AA315A
Energy difference between WT (input) and mutated protein (by FoldX)	0.0 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -1.716
• Maximal score value: 1.9125
• Average score: -0.1857
• Total score value: -9.2831

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
311	M	A	0.8204
312	N	A	-0.7229
313	F	A	1.6199
314	G	A	-0.1180
315	A	A	0.3302	mutated: AA315A
316	F	A	1.9125
317	S	A	0.4634
318	I	A	1.7374
319	N	A	-0.9456
320	P	A	-0.4729
321	A	A	0.1822
322	M	A	1.0834
323	M	A	0.9868
324	A	A	0.1413
325	A	A	0.0736
326	A	A	-0.0068
327	Q	A	-0.6149
328	A	A	-0.1943
329	A	A	0.1845
330	L	A	0.3363
331	Q	A	-1.0119
332	S	A	-0.4659
333	S	A	-0.0339
334	W	A	1.0743
335	G	A	-0.1500
336	M	A	0.8766
337	M	A	1.1430
338	G	A	-0.0527
339	M	A	0.6900
340	L	A	0.7183
341	A	A	0.0946
342	S	A	-0.4284
343	Q	A	-1.4583
344	Q	A	-1.6543
345	N	A	-1.7160
346	Q	A	-1.4553
347	S	A	-0.4229
348	G	A	-0.5340
349	P	A	-0.3786
350	S	A	-0.3033
351	G	A	-0.5038
352	N	A	-1.5496
353	N	A	-1.6525
354	Q	A	-1.2534
355	N	A	-1.6373
356	Q	A	-1.5185
357	G	A	-0.9245
358	N	A	-1.1663
359	M	A	0.5981
360	Q	A	-1.0031