Project name: 41f4df98ed83805

Status: done

submitted: 2018-12-17 16:01:39, status changed: 2018-12-17 16:07:33
Settings
Chain sequence(s) C: KGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKRLHTCQRH
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.1699
Maximal score value
2.2122
Average score
-1.078
Total score value
-81.9309

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
182 K C -2.3969
183 G C -1.9867
184 Q C -2.5913
185 E C -2.4288
186 G C -1.3183
187 S C -0.7582
188 V C 0.9847
189 C C 0.0000
190 L C 0.5077
191 R C -1.4259
192 S C -1.1886
193 S C -1.4678
194 D C -1.8755
195 C C 0.0000
196 A C -1.6458
197 S C -0.8217
198 G C -0.6729
199 L C -0.7460
200 C C 0.0000
201 C C -0.9333
202 A C 0.0000
203 R C 0.2134
204 H C 0.7658
205 F C 2.2122
206 W C 1.8399
207 S C 0.9597
208 K C 0.3306
209 I C -0.0186
210 C C 0.0000
211 K C -1.2697
212 P C -1.0361
213 V C -0.5428
214 L C 0.0000
215 K C -3.1676
216 E C -3.6426
217 G C -2.2980
218 Q C -1.7493
219 V C -0.6076
220 C C 0.0000
221 T C -1.2061
222 K C -2.4035
223 H C -3.1724
224 R C -3.8312
225 R C -4.1699
226 K C -3.4128
227 G C -2.2408
228 S C -2.0374
229 H C -2.1419
230 G C -0.7926
231 L C 0.8758
232 E C 0.4452
233 I C 1.5167
234 F C 1.6064
235 Q C -0.1417
236 R C -1.0739
237 C C 0.0000
238 Y C 0.6332
239 C C -0.8124
240 G C -1.6315
241 E C -2.4814
242 G C -2.4583
243 L C -2.4248
244 S C -1.6130
245 C C -1.1029
246 R C -1.8124
247 I C -1.0007
248 Q C -1.6349
249 K C -2.1750
259 R C -1.5042
260 L C -0.2213
261 H C -0.8396
262 T C -1.4360
263 C C 0.0000
264 Q C -2.7771
265 R C -3.5145
266 H C -2.1680

 

Laboratory of Theory of Biopolymers 2015