Project name: 4eb0 cutinase

Status: done

submitted: 2018-11-12 03:58:02, status changed: 2018-11-24 16:04:17
Settings
Chain sequence(s) A: SNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-2.9448
Maximal score value
2.1041
Average score
-0.5138
Total score value
-132.5524

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
36 S A -0.6829
37 N A -1.0120
38 P A -0.3356
39 Y A 0.3129
40 Q A -0.2809
41 R A -0.9193
42 G A -1.0700
43 P A -1.4863
44 N A -1.5418
45 P A -1.3375
46 T A -1.2936
47 R A -1.9465
48 S A -1.4441
49 A A -1.3689
50 L A 0.0000
51 T A -0.8549
52 A A -1.0338
53 D A -1.7404
54 G A -1.0908
55 P A -0.5146
56 F A -0.0906
57 S A 0.2278
58 V A 0.9923
59 A A 0.7459
60 T A 0.8269
61 Y A 1.2154
62 T A 0.2976
63 V A 0.3085
64 S A -0.5252
65 R A -1.2918
66 L A 0.7556
67 S A 0.8831
68 V A 1.8635
69 S A 0.9295
70 G A 0.2645
71 F A 0.1309
72 G A 0.0000
73 G A -0.8844
74 G A 0.0000
75 V A 0.2547
76 I A 0.0000
77 Y A 0.6634
78 Y A 0.0000
79 P A 0.0000
80 T A 0.0417
81 G A -0.4011
82 T A -0.4300
83 S A -0.4027
84 L A -0.2802
85 T A -0.4418
86 F A 0.0000
87 G A 0.0000
88 G A 0.0000
89 I A 0.0000
90 A A 0.0000
91 M A 0.0000
92 S A 0.0000
93 P A 0.0000
94 G A 0.0000
95 Y A 0.4563
96 T A -0.4580
97 A A -1.0044
98 D A -0.9744
99 A A -0.5784
100 S A -0.3234
101 S A -0.4759
102 L A 0.0000
103 A A -0.0517
104 W A -0.0572
105 L A 0.0000
106 G A 0.0000
107 R A -0.3979
108 R A 0.0000
109 L A 0.0000
110 A A 0.0000
111 S A 0.0000
112 H A 0.0000
113 G A 0.0000
114 F A 0.0000
115 V A 0.0000
116 V A 0.0000
117 L A 0.0000
118 V A 0.0000
119 I A 0.0000
120 N A -0.9338
121 T A -1.0572
122 N A -1.9625
123 S A -1.4340
124 R A -2.0088
125 F A -0.4991
126 D A 0.0000
127 Y A 0.5607
128 P A -0.4565
129 D A -1.5236
130 S A -0.5326
131 R A 0.0000
132 A A 0.0000
133 S A -0.7787
134 Q A -0.5322
135 L A 0.0000
136 S A -0.4723
137 A A -0.4554
138 A A 0.0000
139 L A 0.0000
140 N A -1.2184
141 Y A -0.3959
142 L A 0.0000
143 R A -2.7310
144 T A -1.2736
145 S A 0.0000
146 S A -0.7403
147 P A -0.6934
148 S A -0.9000
149 A A -0.8724
150 V A 0.0000
151 R A -2.5884
152 A A -1.3898
153 R A -1.2928
154 L A 0.0000
155 D A -2.9448
156 A A -2.6202
157 N A -2.4205
158 R A -1.7451
159 L A 0.0000
160 A A 0.0000
161 V A 0.0000
162 A A 0.0000
163 G A 0.0000
164 H A -0.0196
165 S A 0.3001
166 M A 0.1610
167 G A 0.0000
168 G A 0.0000
169 G A -1.0286
170 G A 0.0000
171 T A 0.0000
172 L A 0.0000
173 R A -1.9694
174 I A 0.0000
175 A A 0.0000
176 E A -1.7604
177 Q A -1.9709
178 N A -1.5804
179 P A -1.2762
180 S A -1.2104
181 L A 0.0000
182 K A -0.8385
183 A A 0.0000
184 A A 0.0000
185 V A 0.0000
186 P A 0.0000
187 L A 0.0000
188 T A 0.2180
189 P A 0.0000
190 W A -0.3458
191 H A -1.2275
192 T A -1.6531
193 D A -2.5918
194 K A -2.3494
195 T A -1.5332
196 F A 0.0000
197 N A -1.0688
198 T A -0.7078
199 S A -0.7947
200 V A 0.0000
201 P A -0.4062
202 V A 0.0000
203 L A 0.0000
204 I A 0.0000
205 V A 0.0000
206 G A 0.0000
207 A A 0.0000
208 E A -2.6720
209 A A -1.3913
210 D A -0.5372
211 T A 0.6362
212 V A 1.9775
213 A A 0.5472
214 P A -0.3326
215 V A 0.0000
216 S A -1.0688
217 Q A -1.4063
218 H A -0.5673
219 A A 0.0000
220 I A -0.4824
221 P A -1.0701
222 F A 0.0000
223 Y A 0.0000
224 Q A -1.6718
225 N A -1.8895
226 L A -1.1740
227 P A -0.7506
228 S A -0.4015
229 T A -0.5141
230 T A 0.0000
231 P A -1.1719
232 K A -1.0533
233 V A 0.0000
234 Y A -0.5170
235 V A 0.0000
236 E A -1.2272
237 L A 0.0000
238 D A -2.0952
239 N A -2.1890
240 A A -1.1022
241 S A -0.2246
242 H A 0.6409
243 F A 2.1041
244 A A 0.5158
245 P A -0.4387
246 N A -1.4464
247 S A -0.9480
248 N A -1.0903
249 N A 0.0000
250 A A -0.4943
251 A A -0.3934
252 I A 0.0000
253 S A 0.0000
254 V A 0.0000
255 Y A 0.0000
256 T A 0.0000
257 I A 0.0000
258 S A 0.0000
259 W A 0.0000
260 M A 0.0000
261 K A 0.0000
262 L A 0.0000
263 W A -0.0959
264 V A 0.0000
265 D A 0.0000
266 N A -0.4562
267 D A 0.0000
268 T A -0.8065
269 R A -1.3385
270 Y A 0.0000
271 R A 0.0000
272 Q A -1.4368
273 F A -0.7667
274 L A 0.0000
275 C A -1.2667
276 N A -1.8198
277 V A -1.2257
278 N A -1.8448
279 D A -1.3801
280 P A -0.9846
281 A A -0.9688
282 L A 0.0000
283 S A -1.4727
284 D A -1.5257
285 F A 0.0000
286 R A -1.4155
287 T A -1.4185
288 N A -1.8251
289 N A -1.9781
290 R A -2.4871
291 H A -2.0095
292 C A -1.2349
293 Q A -1.4762

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.5138 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015