Project name: 431d56133a1fe3b

Status: done

submitted: 2019-04-01 16:52:35, status changed: 2019-04-01 19:39:14
Settings
Chain sequence(s) A: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-4.1514
Maximal score value
4.839
Average score
0.5302
Total score value
186.6351

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8624
2 D A -0.1071
3 Y A 1.0344
4 Q A 0.0000
5 V A 2.2468
6 S A 1.5322
7 S A 0.0000
8 P A 1.4588
9 I A 3.1369
10 Y A 2.4597
11 D A 1.4997
12 I A 2.6903
13 N A 1.3309
14 Y A 2.1531
15 Y A 2.0659
16 T A 0.8946
17 S A 0.2280
18 E A -1.4187
19 P A -0.3657
20 C A -0.2638
21 Q A -1.1443
22 K A -0.1727
23 I A 0.6795
24 N A 0.8191
25 V A 1.7002
26 K A 0.4936
27 Q A 0.4223
28 I A 1.2712
29 A A 0.0000
30 A A -0.1633
31 R A -0.9281
32 L A 0.6259
33 L A 0.0000
34 P A 0.1782
35 P A 0.5109
36 L A 1.6449
37 Y A 0.0000
38 S A 1.9028
39 L A 3.2197
40 V A 0.0000
41 F A 3.4952
42 I A 4.8062
43 F A 4.8390
44 G A 0.0000
45 F A 4.4682
46 V A 4.3383
47 G A 3.3514
48 N A 0.0000
49 M A 2.9385
50 L A 2.4861
51 V A 2.0766
52 I A 2.5023
53 L A 2.4898
54 I A 0.0000
55 L A 1.3307
56 I A 1.9437
57 N A 1.1371
58 C A -0.6307
59 K A -2.0947
60 R A -2.6037
61 L A 0.0000
62 K A -2.2283
63 S A -0.7733
64 M A 0.0000
65 T A -0.0690
66 D A 0.0000
67 I A 0.0000
68 Y A 0.0000
69 L A 0.0000
70 L A 0.5702
71 N A 0.0000
72 L A 0.0000
73 A A 0.0000
74 I A 0.8788
75 S A 0.0000
76 D A 0.7222
77 L A 1.5149
78 F A 1.8018
79 F A 1.4598
80 L A 0.0000
81 L A 1.6975
82 T A 0.0000
83 V A 0.0000
84 P A 0.4345
85 F A 0.9546
86 W A 0.0000
87 A A -0.0670
88 H A -0.3111
89 Y A 0.1603
90 A A -0.2690
91 A A -0.4198
92 A A 0.0330
93 Q A -0.3166
94 W A -0.2541
95 D A -1.4811
96 F A 0.0000
97 G A -1.3095
98 N A -1.9608
99 T A -0.8418
100 M A 0.2014
101 C A 0.0000
102 Q A 0.2654
103 L A 1.4812
104 L A 0.0000
105 T A 0.8251
106 G A 0.0000
107 L A 1.6840
108 Y A 1.2998
109 F A 1.6801
110 I A 2.4432
111 G A 0.0000
112 F A 0.9922
113 F A 1.3539
114 S A 0.0000
115 G A 0.5987
116 I A 0.0000
117 F A 1.0263
118 F A 0.0000
119 I A 0.0000
120 I A 1.0101
121 L A 0.9777
122 L A 0.0000
123 T A 0.0000
124 I A 1.7232
125 D A 0.0000
126 R A 0.0000
127 Y A 1.9089
128 L A 1.2037
129 A A 0.9331
130 V A 0.0000
131 V A 0.5409
132 H A 0.1824
133 A A 1.0004
134 V A 1.7781
135 F A 1.1129
136 A A 0.5647
137 L A 0.4557
138 K A -0.9240
139 A A -0.4200
140 R A -1.3877
141 T A 0.0000
142 V A 0.9705
143 T A 1.4565
144 F A 2.1034
145 G A 0.0000
146 V A 3.4908
147 V A 3.8557
148 T A 0.0000
149 S A 0.0000
150 V A 4.1216
151 I A 4.2011
152 T A 0.0000
153 W A 3.6890
154 V A 4.5803
155 V A 4.1061
156 A A 0.0000
157 V A 3.8457
158 F A 3.9924
159 A A 2.7201
160 S A 0.0000
161 L A 3.0403
162 P A 2.1211
163 G A 1.5490
164 I A 2.1859
165 I A 2.8040
166 F A 1.7070
167 T A -0.2303
168 R A -1.9350
169 S A -2.2624
170 Q A -2.5173
171 K A -2.8386
172 E A -2.0157
173 G A -1.1962
174 L A -0.4988
175 H A -0.9448
176 Y A 0.0000
177 T A -0.9375
178 C A -0.9217
179 S A -0.6536
180 S A -0.0702
181 H A 0.2594
182 F A 2.0338
183 P A 1.0082
184 Y A 1.4911
185 S A 0.0902
186 Q A -0.1776
187 Y A 1.0533
188 Q A 1.5114
189 F A 2.6184
190 W A 1.9128
191 K A 0.9495
192 N A 1.7791
193 F A 2.5600
194 Q A 1.0627
195 T A 0.0000
196 L A 1.8993
197 K A 0.1190
198 I A 1.0277
199 V A 2.0467
200 I A 2.1295
201 L A 1.4559
202 G A 0.0000
203 L A 2.4006
204 V A 2.7445
205 L A 2.8755
206 P A 0.0000
207 L A 2.7957
208 L A 3.3513
209 V A 3.2676
210 M A 3.0514
211 V A 3.7872
212 I A 3.9201
213 C A 0.0000
214 Y A 2.9397
215 S A 2.1123
216 G A 1.7209
217 I A 1.8579
218 L A 2.1640
219 K A 0.0324
220 T A 0.3379
221 L A 1.5466
222 L A 1.2274
223 R A -0.7536
224 C A -0.0146
225 R A -1.1919
226 N A -2.3881
227 E A -2.9199
228 K A -3.7864
229 K A -4.1514
230 R A -3.3785
231 H A -2.9097
232 R A -3.5426
233 A A 0.0000
234 V A -1.3268
235 R A -2.1550
236 L A -0.2560
237 I A 0.0000
238 F A 0.4171
239 T A 0.2528
240 I A 0.0000
241 M A 0.0000
242 I A 1.4624
243 V A 1.3599
244 Y A 1.1632
245 F A 0.0000
246 L A 2.1452
247 F A 1.8265
248 W A 0.0000
249 A A 1.5440
250 P A 1.3234
251 Y A 1.4509
252 N A 0.0000
253 I A 2.4430
254 V A 0.0000
255 L A 2.0057
256 L A 2.4299
257 L A 2.3883
258 N A 1.7619
259 T A 1.6810
260 F A 2.6636
261 Q A 1.3162
262 E A 0.8818
263 F A 2.7965
264 F A 2.3348
265 G A 0.4759
266 L A 0.4550
267 N A -1.2729
268 N A -1.6395
269 C A -0.8059
270 S A -1.3267
271 S A -1.6476
272 S A -1.7075
273 N A -2.2274
274 R A -2.4489
275 L A -1.0590
276 D A -1.4875
277 Q A -1.2146
278 A A -0.4347
279 M A 0.3896
280 Q A 0.0000
281 V A 1.0425
282 T A 0.9084
283 E A 0.3789
284 T A 0.0000
285 L A 1.3054
286 G A 0.6514
287 M A 0.0000
288 T A 1.0611
289 H A 0.8814
290 C A 0.7731
291 C A 0.0000
292 I A 1.8942
293 N A 0.0000
294 P A 2.2172
295 I A 3.0919
296 I A 2.0832
297 Y A 0.0000
298 A A 1.0834
299 F A 1.8176
300 V A 0.0000
301 G A 0.0000
302 E A -1.2585
303 K A -1.2205
304 F A 0.0000
305 R A -1.1664
306 N A -0.3477
307 Y A 0.3826
308 L A 1.1750
309 L A 1.4260
310 V A 1.0158
311 F A 0.9700
312 F A 1.7952
313 Q A -0.0867
314 K A -1.1246
315 H A -0.4350
316 I A -0.0128
317 A A -1.2023
318 K A -2.5134
319 R A -2.3433
320 F A 0.2230
321 C A -0.7454
322 K A -1.2643
323 C A 0.3988
324 C A 0.5714
325 S A 0.0156
326 I A 1.0772
327 F A -0.4223
328 Q A -1.4818
329 Q A -1.7347
330 E A -2.7780
331 A A -2.1707
332 P A -1.8649
333 E A -2.8305
334 R A -2.5942
335 A A -1.4025
336 S A -1.0026
337 S A -0.7636
338 V A 0.6944
339 Y A 0.2935
340 T A -0.7699
341 R A -1.5771
342 S A -0.9883
343 T A -1.1049
344 G A -1.5383
345 E A -1.9053
346 Q A -1.1880
347 E A -0.8204
348 I A 0.9905
349 S A 0.9657
350 V A 1.6244
351 G A 1.2299
352 L A 2.0417

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, 0.5302 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015