Project name: SH3_E93Y

Status: done

submitted: 2019-03-14 15:15:15, status changed: 2019-03-14 16:06:01
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues EA93Y
Energy difference between WT (input) and mutated protein (by FoldX) -1.03673 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.9363
Maximal score value
1.2498
Average score
-0.7446
Total score value
-44.6745

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6148
88 A A 0.0000
89 L A -0.2420
90 Y A -0.5768
91 D A -1.8390
92 Y A -0.4591
93 Y A 0.2870 mutated: EA93Y
94 S A -0.6861
95 R A -2.0723
96 T A -1.7837
97 E A -2.3568
98 T A -1.2502
99 D A -0.8885
100 L A 0.0000
101 S A -0.6456
102 F A 0.0000
103 K A -2.8218
104 K A -2.7202
105 G A -1.9009
106 E A 0.0000
107 R A -2.0638
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6978
120 L A 0.4047
121 A A 0.0000
122 H A -0.3841
123 S A 0.0000
124 L A -0.2797
125 T A -0.7725
126 T A -0.8759
127 G A -0.8170
128 Q A -1.4198
129 T A -0.5020
130 G A 0.0000
131 Y A 0.2102
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.1611
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015