Project name: SH3_S140I

Status: done

submitted: 2019-03-14 17:16:09, status changed: 2019-03-14 18:50:25
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues SA140I
Energy difference between WT (input) and mutated protein (by FoldX) -1.25637 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4726
Maximal score value
2.0495
Average score
-0.7856
Total score value
-47.1369

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4506
82 S A -0.6820
83 H A -0.7908
84 M A 0.7329
85 T A 0.0000
86 F A 0.7122
87 V A 0.0007
88 A A 0.0000
89 L A -0.3412
90 Y A -0.7500
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3229
100 L A 0.0000
101 S A -1.9034
102 F A 0.0000
103 K A -3.4726
104 K A -2.8554
105 G A -1.9444
106 E A 0.0000
107 R A -1.5413
108 L A 0.0000
109 Q A -0.2088
110 I A 0.4596
111 V A 1.2508
112 N A -0.4196
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6978
120 L A 0.4052
121 A A 0.0000
122 H A -0.3442
123 S A 0.0000
124 L A -0.1814
125 T A -0.7015
126 T A -0.8398
127 G A -0.8056
128 Q A -1.4057
129 T A -0.4903
130 G A 0.0000
131 Y A 0.2197
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2202
137 V A 0.0000
138 A A 0.4960
139 P A 0.9303
140 I A 2.0495 mutated: SA140I

 

Laboratory of Theory of Biopolymers 2015