Project name: SH3_S94F

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94F
Energy difference between WT (input) and mutated protein (by FoldX)	4.85162 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4964
• Maximal score value: 1.2501
• Average score: -0.8907
• Total score value: -53.4434

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1031
87	V	A	-0.6247
88	A	A	0.0000
89	L	A	-0.3282
90	Y	A	-0.7740
91	D	A	-2.8783
92	Y	A	-1.9424
93	E	A	-2.5022
94	F	A	-1.3750	mutated: SA94F
95	R	A	-2.3915
96	T	A	-1.8825
97	E	A	-2.1911
98	T	A	-1.0825
99	D	A	-1.0092
100	L	A	0.0000
101	S	A	-1.6091
102	F	A	0.0000
103	K	A	-3.4964
104	K	A	-2.8786
105	G	A	-1.9683
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4182
113	N	A	-1.8118
114	T	A	-1.7313
115	E	A	-2.9334
116	G	A	-2.6087
117	D	A	-2.6859
118	W	A	-1.3310
119	W	A	-0.6898
120	L	A	0.4166
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8766
127	G	A	-0.8169
128	Q	A	-1.4024
129	T	A	-0.4794
130	G	A	0.0000
131	Y	A	0.3474
132	I	A	0.0000
133	P	A	-0.5494
134	S	A	-1.2904
135	N	A	-1.2530
136	Y	A	-0.2124
137	V	A	0.0000
138	A	A	-0.0188
139	P	A	-0.1505
140	S	A	-0.1759