Project name: CH2 A3D [mutate: FA241K]

Status: done

submitted: 2018-11-18 11:57:11, status changed: 2018-11-18 12:04:31
Settings
Chain sequence(s) A: GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues FA241K
Energy difference between WT (input) and mutated protein (by FoldX) 0.135435 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.6517
Maximal score value
1.8177
Average score
-1.1075
Total score value
-118.5045

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
236 G A -0.7925
237 G A -0.8711
238 P A 0.0000
239 S A -0.8940
240 V A 0.0000
241 K A -1.1740 mutated: FA241K
242 L A 0.0000
243 F A 0.4349
244 P A -0.6693
245 P A 0.0000
246 K A -2.3658
247 P A -1.5745
248 K A -1.6650
249 D A 0.0000
250 T A 0.0000
251 L A 1.0894
252 M A 1.1315
253 I A 1.8177
254 S A 0.2677
255 R A -1.3465
256 T A -0.7379
257 P A 0.0000
258 E A -1.0291
259 V A 0.0000
260 T A -0.0269
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A 0.0000
265 D A -1.5947
266 V A 0.0000
267 S A -2.2238
268 H A -2.2504
269 E A -2.8840
270 D A -2.6301
271 P A -2.4854
272 E A -3.0473
273 V A -1.9207
274 K A -2.2497
275 F A -1.2744
276 N A -1.4679
277 W A 0.0000
278 Y A -0.9098
279 V A -0.9566
280 D A -1.9563
281 G A -0.9064
282 V A 0.3523
283 E A -1.2378
284 V A -0.6698
285 H A -1.7594
286 N A -1.6613
287 A A -1.5995
288 K A -2.2817
289 T A -1.9264
290 K A -2.5961
291 P A -2.4636
292 R A -3.4447
293 E A -3.6517
294 E A -3.0183
295 Q A -1.4920
296 Y A 0.2895
297 N A -0.6762
298 S A -1.1290
299 T A -1.8780
300 Y A -2.5448
301 R A -2.7752
302 V A 0.0000
303 V A -1.2960
304 S A 0.0000
305 V A -0.7300
306 L A 0.0000
307 T A -0.4655
308 V A 0.0000
309 L A 1.0189
310 H A 0.5003
311 Q A -0.5316
312 D A -1.2991
313 W A 0.0000
314 L A -0.5332
315 N A -1.8670
316 G A -2.3342
317 K A -2.3535
318 E A -2.7016
319 Y A 0.0000
320 K A -1.7956
321 C A 0.0000
322 K A -1.8003
323 V A 0.0000
324 S A -1.5182
325 N A 0.0000
326 K A -2.5631
327 A A -1.4094
328 L A -0.6455
329 P A -0.4352
330 A A -0.4359
331 P A -0.9813
332 I A -0.9273
333 E A -2.3584
334 K A -1.9172
335 T A -1.8525
336 I A 0.0000
337 S A -2.4576
338 K A -2.8492
339 A A -1.9935
340 K A -2.6748
341 G A -2.0881
342 Q A -1.8823

 

Laboratory of Theory of Biopolymers 2015