Project name: SH3_Y92T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92T
Energy difference between WT (input) and mutated protein (by FoldX)	6.07101 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5404
• Maximal score value: 1.2501
• Average score: -0.9577
• Total score value: -57.4612

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1010
87	V	A	-0.6135
88	A	A	0.0000
89	L	A	-0.3149
90	Y	A	-0.7570
91	D	A	-2.9568
92	T	A	-2.3766	mutated: YA92T
93	E	A	-3.0413
94	S	A	-2.3014
95	R	A	-2.8499
96	T	A	-2.2067
97	E	A	-2.3985
98	T	A	-1.3155
99	D	A	-1.4954
100	L	A	0.0000
101	S	A	-2.0301
102	F	A	0.0000
103	K	A	-3.5404
104	K	A	-2.8847
105	G	A	-1.9557
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4046
113	N	A	-1.7911
114	T	A	-1.7170
115	E	A	-2.9051
116	G	A	-2.5801
117	D	A	-2.6364
118	W	A	-1.2529
119	W	A	-0.6645
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8781
127	G	A	-0.8169
128	Q	A	-1.4271
129	T	A	-0.5205
130	G	A	0.0000
131	Y	A	0.1824
132	I	A	0.0000
133	P	A	-0.5640
134	S	A	-1.2523
135	N	A	-1.2223
136	Y	A	-0.2002
137	V	A	0.0000
138	A	A	-0.0149
139	P	A	-0.1505
140	S	A	-0.1759