Project name: SH3_W118N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA118N
Energy difference between WT (input) and mutated protein (by FoldX)	1.44591 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4631
• Maximal score value: 1.2522
• Average score: -0.9864
• Total score value: -59.1854

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3032
90	Y	A	-0.7165
91	D	A	-2.8129
92	Y	A	-2.0408
93	E	A	-2.8583
94	S	A	0.0000
95	R	A	-2.7972
96	T	A	-2.1877
97	E	A	-2.3837
98	T	A	-1.2928
99	D	A	-1.5501
100	L	A	0.0000
101	S	A	-1.9024
102	F	A	0.0000
103	K	A	-3.4631
104	K	A	-2.8482
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2489
110	I	A	0.4395
111	V	A	1.2522
112	N	A	-0.5544
113	N	A	-2.0193
114	T	A	-1.8764
115	E	A	-3.2197
116	G	A	-2.9022
117	D	A	-3.1940
118	N	A	-2.3971	mutated: WA118N
119	W	A	-1.2184
120	L	A	0.1598
121	A	A	0.0000
122	H	A	-0.3814
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4237
129	T	A	-0.5118
130	G	A	0.0000
131	Y	A	-0.1057
132	I	A	0.0000
133	P	A	-0.9667
134	S	A	-1.6290
135	N	A	-1.4027
136	Y	A	-0.3080
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759