Project name: SH3_L120T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120T
Energy difference between WT (input) and mutated protein (by FoldX)	1.66286 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4774
• Maximal score value: 1.1056
• Average score: -0.9135
• Total score value: -54.8086

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4506
82	S	A	-0.6820
83	H	A	-0.7908
84	M	A	0.2676
85	T	A	0.0000
86	F	A	-0.1038
87	V	A	-0.6187
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.7095
91	D	A	-2.8409
92	Y	A	-2.1031
93	E	A	-2.8839
94	S	A	0.0000
95	R	A	-2.7847
96	T	A	-2.1334
97	E	A	-2.3317
98	T	A	-1.2298
99	D	A	-1.2917
100	L	A	0.0000
101	S	A	-1.8786
102	F	A	0.0000
103	K	A	-3.4774
104	K	A	-2.8504
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0694
108	L	A	0.0000
109	Q	A	-0.3041
110	I	A	0.3411
111	V	A	1.1056
112	N	A	-0.6482
113	N	A	-1.9362
114	T	A	-1.8151
115	E	A	-3.0021
116	G	A	-2.6277
117	D	A	-2.6723
118	W	A	-1.3921
119	W	A	-0.8305
120	T	A	0.1351	mutated: LA120T
121	A	A	0.0000
122	H	A	-0.4342
123	S	A	0.0000
124	L	A	-0.2739
125	T	A	-0.7775
126	T	A	-0.8759
127	G	A	-0.8137
128	Q	A	-1.4115
129	T	A	-0.5155
130	G	A	0.0000
131	Y	A	0.2606
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3022
135	N	A	-1.2493
136	Y	A	-0.2016
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1501
140	S	A	-0.1759