Project name: 4d4d0ab4394c003 [mutate: DA51E]

Status: done

submitted: 2021-09-30 09:34:18, status changed: 2021-09-30 18:30:08
Settings
Chain sequence(s) A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues DA51E
Energy difference between WT (input) and mutated protein (by FoldX) 1.49769 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.324
Maximal score value
0.1419
Average score
-1.1599
Total score value
-114.829

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A -0.5101
2 D A -1.3395
3 V A 0.0000
4 L A -0.2789
5 L A 0.0000
6 G A 0.0000
7 A A -1.3436
8 D A -2.6885
9 D A -2.8698
10 G A -1.8110
11 S A -0.9389
12 L A -0.0976
13 A A 0.1419
14 F A 0.0000
15 V A 0.0138
16 P A -0.3910
17 S A -0.6943
18 E A -1.9182
19 F A -0.8180
20 S A -1.1170
21 I A 0.0000
22 S A -1.6360
23 P A -1.8094
24 G A -1.3548
25 E A -1.5589
26 K A -2.2240
27 I A 0.0000
28 V A -1.2862
29 F A 0.0000
30 K A -1.4663
31 N A 0.0000
32 N A -1.3654
33 A A -1.2160
34 G A -0.8381
35 F A -0.2510
36 P A -0.5504
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -2.1230
43 E A -3.3240
44 D A -2.9228
45 S A -2.1398
46 I A -2.1849
47 P A -1.8282
48 S A -1.3552
49 G A -0.9834
50 V A -1.6171
51 E A -2.6678 mutated: DA51E
52 A A -2.3714
53 S A -1.8387
54 K A -2.2903
55 I A 0.0000
56 S A -1.5662
57 M A -1.1248
58 S A -1.8622
59 E A -2.9589
60 E A -3.1081
61 D A -2.3430
62 L A -0.8149
63 L A 0.0000
64 N A -1.5801
65 A A -1.6414
66 K A -2.4682
67 G A -1.9007
68 E A -1.6912
69 T A -1.3660
70 F A -0.8304
71 E A -2.0320
72 V A 0.0000
73 A A -1.6256
74 L A 0.0000
75 S A -1.8115
76 N A -2.6921
77 K A -3.2198
78 G A -2.3716
79 E A -2.5121
80 Y A 0.0000
81 S A -1.4848
82 F A 0.0000
83 Y A -0.3294
84 C A 0.0000
85 S A -1.1686
86 P A -0.8934
87 H A -0.5979
88 Q A -0.9723
89 G A -0.9386
90 A A -0.5229
91 G A -0.5169
92 M A 0.0000
93 V A 0.0831
94 G A 0.0000
95 K A -1.6714
96 V A 0.0000
97 T A -2.0483
98 V A 0.0000
99 N A -2.3830

 

Laboratory of Theory of Biopolymers 2015