Project name: SH3_W118C

Status: done

submitted: 2019-03-14 15:30:35, status changed: 2019-03-14 17:40:46
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues WA118C
Energy difference between WT (input) and mutated protein (by FoldX) 1.88681 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4587
Maximal score value
1.2486
Average score
-0.9177
Total score value
-55.0601

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1038
87 V A -0.6194
88 A A 0.0000
89 L A -0.2931
90 Y A -0.6978
91 D A -2.8036
92 Y A -2.0293
93 E A -2.8488
94 S A 0.0000
95 R A -2.7849
96 T A -2.1706
97 E A -2.3681
98 T A -1.2684
99 D A -1.3942
100 L A 0.0000
101 S A -1.8906
102 F A 0.0000
103 K A -3.4587
104 K A -2.8402
105 G A -1.9589
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4359
111 V A 1.2486
112 N A -0.4442
113 N A -1.8499
114 T A -1.7567
115 E A -2.9835
116 G A -2.6618
117 D A -2.7800
118 C A -1.5377 mutated: WA118C
119 W A -0.8008
120 L A 0.3486
121 A A 0.0000
122 H A -0.3855
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4170
129 T A -0.5059
130 G A 0.0000
131 Y A 0.1318
132 I A 0.0000
133 P A -0.6397
134 S A -1.3599
135 N A -1.2806
136 Y A -0.2114
137 V A 0.0000
138 A A -0.0203
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015