Project name: Calcitonin Salmon

Chain sequence(s)	A: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -2.0037
• Maximal score value: 1.5104
• Average score: -0.3525
• Total score value: -11.2803

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	C	A	0.7183
2	S	A	-0.1334
3	N	A	-0.2049
4	L	A	1.3670
5	S	A	0.8830
6	T	A	0.6623
7	C	A	0.8453
8	V	A	1.4726
9	L	A	1.5104
10	G	A	0.0611
11	K	A	-1.0266
12	L	A	0.4561
13	S	A	-0.1118
14	Q	A	-1.2794
15	E	A	-1.4077
16	L	A	0.0196
17	H	A	-1.3015
18	K	A	-1.2190
19	L	A	0.3033
20	Q	A	-0.9835
21	T	A	-0.8904
22	Y	A	-0.1278
23	P	A	-0.7361
24	R	A	-2.0037
25	T	A	-1.2150
26	N	A	-1.2406
27	T	A	-0.7888
28	G	A	-1.0232
29	S	A	-1.0017
30	G	A	-1.2837
31	T	A	-1.0759
32	P	A	-0.5246