Project name: 4f02933e0818157

Status: done

submitted: 2018-11-27 16:37:51, status changed: 2018-11-27 16:42:35
Settings
Chain sequence(s) A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.232
Maximal score value
0.1656
Average score
-1.1451
Total score value
-113.3673

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A -0.5032
2 D A -1.3061
3 V A 0.0000
4 L A -0.2664
5 L A 0.0000
6 G A 0.0000
7 A A -1.3308
8 D A -2.6828
9 D A -2.8633
10 G A -1.7950
11 S A -0.9119
12 L A -0.0428
13 A A 0.1656
14 F A 0.0000
15 V A 0.0223
16 P A -0.4183
17 S A -0.7614
18 E A -2.0178
19 F A -0.8803
20 S A -1.1600
21 I A 0.0000
22 S A -1.6384
23 P A -1.8130
24 G A -1.3598
25 E A -1.5799
26 K A -2.2404
27 I A 0.0000
28 V A -1.2785
29 F A 0.0000
30 K A -1.4560
31 N A 0.0000
32 N A -1.3514
33 A A -1.1962
34 G A -0.8120
35 F A -0.2112
36 P A -0.5238
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -2.1453
43 E A -3.2320
44 D A -2.9304
45 S A -2.1813
46 I A -2.1428
47 P A -1.7555
48 S A -1.2732
49 G A -0.8362
50 V A -1.3216
51 D A -2.0730
52 A A -2.0852
53 S A -1.6436
54 K A -2.1104
55 I A 0.0000
56 S A -1.4935
57 M A -1.1180
58 S A -1.8549
59 E A -2.9518
60 E A -3.0975
61 D A -2.3210
62 L A -0.7845
63 L A 0.0000
64 N A -1.5638
65 A A -1.6316
66 K A -2.4611
67 G A -1.8949
68 E A -1.6820
69 T A -1.3595
70 F A -0.8301
71 E A -2.0318
72 V A 0.0000
73 A A -1.6345
74 L A 0.0000
75 S A -1.8118
76 N A -2.6894
77 K A -3.2191
78 G A -2.3718
79 E A -2.5795
80 Y A 0.0000
81 S A -1.6092
82 F A 0.0000
83 Y A -0.3809
84 C A 0.0000
85 S A -1.1726
86 P A -0.8938
87 H A -0.5954
88 Q A -0.9879
89 G A -0.9496
90 A A -0.5184
91 G A -0.5148
92 M A 0.0000
93 V A 0.0259
94 G A 0.0000
95 K A -1.9481
96 V A 0.0000
97 T A -2.1146
98 V A 0.0000
99 N A -2.3825

 

Laboratory of Theory of Biopolymers 2015