Project name: SH3_T98K

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA98K
Energy difference between WT (input) and mutated protein (by FoldX)	-1.04271 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4841
• Maximal score value: 1.2339
• Average score: -0.9831
• Total score value: -58.9863

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8530
92	Y	A	-2.0976
93	E	A	-2.8691
94	S	A	0.0000
95	R	A	-2.9833
96	T	A	-2.6346
97	E	A	-3.1311
98	K	A	-2.8685	mutated: TA98K
99	D	A	-2.0929
100	L	A	0.0000
101	S	A	-2.0809
102	F	A	0.0000
103	K	A	-3.4841
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2485
110	I	A	0.4207
111	V	A	1.2339
112	N	A	-0.4372
113	N	A	-1.8289
114	T	A	-1.7317
115	E	A	-2.9356
116	G	A	-2.6082
117	D	A	-2.7005
118	W	A	-1.3748
119	W	A	-0.7390
120	L	A	0.1451
121	A	A	0.0000
122	H	A	-0.4051
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8781
127	G	A	-0.8169
128	Q	A	-1.4044
129	T	A	-0.7680
130	G	A	0.0000
131	Y	A	-0.3196
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3055
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759