Project name: 5E10

Status: done

submitted: 2019-01-10 06:30:26, status changed: 2019-01-10 09:08:20
Settings
Chain sequence(s) A: QVKLEESGGGSVQSGGSLRLACSASGPLGYPSIAWFRQVTGKDQEFVAGIAWSGGDTYYADSVKGRFAISRDTDRNTVELQMNNLKPEDTAVYYCAADTVVHYMGRHDIRDREEYDHWGQGTQVTVSSEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-3.5152
Maximal score value
2.2032
Average score
-0.9003
Total score value
-324.1255

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.5104
2 V A -1.0522
3 K A -1.9453
4 L A 0.0000
5 E A -2.2051
6 E A -1.7860
7 S A -1.3680
8 G A -1.3829
9 G A -1.3028
10 G A -1.0717
11 S A -0.7223
12 V A -1.1758
13 Q A -2.2621
14 S A -1.9966
15 G A -1.4764
16 G A -1.3103
17 S A -1.1843
18 L A -1.3231
19 R A -2.2899
20 L A 0.0000
21 A A -1.2169
22 C A 0.0000
23 S A -1.4573
24 A A -1.1074
25 S A -1.0937
26 G A -0.4900
27 P A 0.1346
28 L A 0.4837
29 G A 0.4630
30 Y A 0.9703
31 P A 0.3688
32 S A -0.3739
33 I A 0.0000
34 A A 0.3965
35 W A 0.0000
36 F A 0.4203
37 R A -0.4080
38 Q A -1.2121
39 V A -1.6731
40 T A -1.7369
41 G A -1.8230
42 K A -3.0559
43 D A -3.0747
44 Q A -1.9731
45 E A -0.9264
46 F A 0.9530
47 V A 0.0000
48 A A 0.0000
49 G A 0.7664
50 I A 0.0000
51 A A -0.5790
52 W A -0.4469
53 S A -0.4305
54 G A -1.0432
55 G A -1.3934
56 D A -1.6154
57 T A -0.1935
58 Y A 1.1580
59 Y A 1.1593
60 A A 0.1792
61 D A -1.0356
62 S A -0.8133
63 V A 0.0020
64 K A -1.9354
65 G A -1.8353
66 R A -1.9736
67 F A -0.5439
68 A A -0.2035
69 I A -0.2341
70 S A -0.7584
71 R A -1.5225
72 D A -2.1623
73 T A -1.6767
74 D A -2.7832
75 R A -2.7106
76 N A 0.0000
77 T A -1.4904
78 V A 0.0000
79 E A -1.3286
80 L A 0.0000
81 Q A -1.7050
82 M A 0.0000
83 N A -2.3675
84 N A -2.0739
85 L A -1.8394
86 K A -2.5574
87 P A -2.4039
88 E A -2.3542
89 D A -2.4172
90 T A -1.3758
91 A A 0.0000
92 V A -0.5376
93 Y A 0.0000
94 Y A -0.2214
95 C A 0.0000
96 A A 0.0000
97 A A 0.0000
98 D A -1.8362
99 T A 0.0000
100 V A -0.7156
101 V A -0.3804
102 H A -0.8878
103 Y A 0.0423
104 M A -0.1260
105 G A -0.7054
106 R A -1.8448
107 H A -1.7590
108 D A -1.1176
109 I A -0.0859
110 R A -1.9871
111 D A -3.0008
112 R A -2.9587
113 E A -2.5157
114 E A -2.7449
115 Y A -1.2467
116 D A -2.0641
117 H A -1.0920
118 W A -0.1642
119 G A -0.8752
120 Q A -1.3059
121 G A -1.3039
122 T A 0.0000
123 Q A -1.5687
124 V A 0.0000
125 T A -1.3442
126 V A -1.7396
127 S A -2.2112
128 S A -2.1717
129 E A -2.8535
130 P A -2.2978
131 K A -2.5900
132 S A -1.5390
133 C A -0.8389
134 D A 0.0000
135 K A -1.9080
136 T A -1.1369
137 H A -1.4343
138 T A -1.2038
139 C A -0.5713
140 P A -0.5208
141 P A -0.2587
142 C A -0.2004
143 P A -0.6035
144 A A -0.4167
145 P A -0.3570
146 E A -0.9873
147 L A 1.2252
148 L A 1.5257
149 G A 0.1645
150 G A 0.2139
151 P A 0.1835
152 S A 0.5203
153 V A 0.6012
154 F A 2.2032
155 L A 1.3644
156 F A 1.6561
157 P A 0.0669
158 P A -0.3505
159 K A -1.0888
160 P A -0.9559
161 K A -0.8289
162 D A -1.1469
163 T A -0.8138
164 L A 0.0000
165 M A 0.2041
166 I A 1.2565
167 S A -0.3229
168 R A -1.5530
169 T A -0.7695
170 P A -0.7971
171 E A -0.3028
172 V A 0.0000
173 T A 0.0000
174 C A 0.0000
175 V A 1.3478
176 V A 0.0000
177 V A 0.2779
178 D A -0.2602
179 V A 0.2185
180 S A -0.7666
181 H A -1.6162
182 E A -3.0247
183 D A -3.3015
184 P A -2.7288
185 E A -2.8826
186 V A -1.8019
187 K A -2.2650
188 F A -1.2661
189 N A -1.6481
190 W A 0.0000
191 Y A -0.5737
192 V A -0.6010
193 D A -1.5229
194 G A -0.3985
195 V A 0.5271
196 E A -1.2089
197 V A -0.5192
198 H A -1.7479
199 N A -1.6726
200 A A -1.5618
201 K A -2.1932
202 T A -1.4386
203 K A -2.0518
204 P A -1.8348
205 R A -2.6180
206 E A -3.3119
207 E A -2.6703
208 Q A -1.9315
209 Y A -0.2100
210 N A -1.0191
211 S A -1.1516
212 T A -1.0104
213 Y A -1.2249
214 R A -1.2893
215 V A -0.4343
216 V A -0.4184
217 S A 0.0000
218 V A -0.3280
219 L A 0.0000
220 T A -0.3197
221 V A 0.0000
222 L A 0.7153
223 H A -0.7203
224 Q A -1.6456
225 D A -2.0823
226 W A -1.1333
227 L A -0.8483
228 N A -2.3915
229 G A -2.4874
230 K A -2.6208
231 E A -2.2276
232 Y A 0.0000
233 K A -1.6833
234 C A 0.0000
235 K A -2.1647
236 V A 0.0000
237 S A -1.5714
238 N A 0.0000
239 K A -2.4268
240 A A -1.7104
241 L A -0.3792
242 P A -0.4195
243 A A 0.0000
244 P A -1.4243
245 I A -1.2219
246 E A -2.9557
247 K A -2.5386
248 T A -1.9900
249 I A 0.0000
250 S A -2.2828
251 K A -2.1301
252 A A -2.1837
253 K A -2.8687
254 G A -2.7014
255 Q A -2.4895
256 P A -2.3457
257 R A -2.4455
258 E A -1.6835
259 P A 0.0000
260 Q A -0.4108
261 V A 0.3754
262 Y A 1.5894
263 T A 1.2177
264 L A 1.6153
265 P A 0.4090
266 P A -0.8782
267 S A -2.0963
268 R A -3.1585
269 E A -3.5152
270 E A -3.0929
271 M A -2.0042
272 T A -2.0569
273 K A -2.5988
274 N A -2.6721
275 Q A -2.2988
276 V A 0.0000
277 S A -0.6515
278 L A 0.0000
279 T A 0.5719
280 C A 0.0000
281 L A 1.3856
282 V A 0.0000
283 K A 0.3611
284 G A 0.0000
285 F A -0.0608
286 Y A 0.0174
287 P A -1.0166
288 S A -1.2751
289 D A -0.6476
290 I A -0.3668
291 A A 0.0000
292 V A -0.1999
293 E A -0.6653
294 W A 0.0000
295 E A -1.9346
296 S A 0.0000
297 N A -1.7449
298 G A -2.0021
299 Q A -2.3719
300 P A -1.9249
301 E A -1.7362
302 N A -1.2683
303 N A -1.0094
304 Y A -0.4529
305 K A -1.0828
306 T A -0.5179
307 T A -0.3761
308 P A 0.2267
309 P A 0.5654
310 V A 1.0974
311 L A 0.7914
312 D A -1.4455
313 S A -1.4889
314 D A -2.0685
315 G A -0.6907
316 S A -0.0197
317 F A 0.9015
318 F A 1.5153
319 L A 1.3236
320 Y A 0.6499
321 S A 0.0000
322 K A -0.7682
323 L A 0.0000
324 T A 0.0000
325 V A 0.0000
326 D A -1.8828
327 K A -2.0687
328 S A -1.6507
329 R A -1.2875
330 W A -1.2014
331 Q A -2.1795
332 Q A -1.9931
333 G A -1.2103
334 N A -0.5648
335 V A 0.9764
336 F A 0.0000
337 S A -0.7558
338 C A 0.0000
339 S A 0.0000
340 V A 0.0000
341 M A 0.0000
342 H A -1.0832
343 E A -1.8765
344 A A -1.1079
345 L A -0.2025
346 H A -1.1499
347 N A -1.8004
348 H A -0.7764
349 Y A 0.0802
350 T A -0.3620
351 Q A -0.7711
352 K A 0.0000
353 S A -0.4315
354 L A 0.0000
355 S A 0.3457
356 L A 0.2790
357 S A -0.2040
358 P A -1.0825
359 G A -1.4475
360 K A -1.9812

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.9003 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015