Project name: SH3_G105V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	GA105V
Energy difference between WT (input) and mutated protein (by FoldX)	4.42549 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -2.9343
• Maximal score value: 1.2558
• Average score: -0.7693
• Total score value: -46.1572

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4506
82	S	A	-0.6820
83	H	A	-0.7908
84	M	A	0.2676
85	T	A	0.0000
86	F	A	0.1645
87	V	A	0.0771
88	A	A	0.0000
89	L	A	0.2918
90	Y	A	-0.2802
91	D	A	-2.4773
92	Y	A	-2.0753
93	E	A	-2.8709
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1546
97	E	A	-2.3532
98	T	A	-1.2427
99	D	A	-1.3251
100	L	A	0.0000
101	S	A	-1.8900
102	F	A	0.0000
103	K	A	-2.7973
104	K	A	-1.6569
105	V	A	0.3308	mutated: GA105V
106	E	A	0.0000
107	R	A	-1.5046
108	L	A	0.0000
109	Q	A	-0.2452
110	I	A	0.4416
111	V	A	1.2558
112	N	A	-0.4087
113	N	A	-1.8092
114	T	A	-1.7294
115	E	A	-2.9343
116	G	A	-2.6073
117	D	A	-2.6850
118	W	A	-1.3424
119	W	A	-0.6960
120	L	A	0.4072
121	A	A	0.0000
122	H	A	-0.3820
123	S	A	0.0000
124	L	A	-0.2779
125	T	A	-0.4805
126	T	A	-0.8696
127	G	A	-0.8164
128	Q	A	-1.4116
129	T	A	-0.4956
130	G	A	0.0000
131	Y	A	0.2160
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2863
135	N	A	-1.2485
136	Y	A	-0.1943
137	V	A	0.0000
138	A	A	-0.0238
139	P	A	-0.1522
140	S	A	-0.1782