Project name: Mutant_aggregation

Status: done

submitted: 2018-12-13 13:26:53, status changed: 2018-12-13 13:34:23
Settings
Chain sequence(s) B: TDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAP
Distance of aggregation 5 Å
Dynamic mode No
Mutated residues TB7S
Energy difference between WT (input) and mutated protein (by FoldX) -0.0870697 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.2051
Maximal score value
1.9888
Average score
-0.3939
Total score value
-47.6646

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 S B -0.5356 mutated: TB7S
8 D B -1.8278
9 M B 0.0000
10 L B 0.8492
11 P B 0.0557
12 E B 0.0000
13 I B 0.0000
14 A B 0.0296
15 A B -0.0123
16 A B 0.0000
17 V B 0.0000
18 G B -0.2583
19 F B 0.1430
20 L B 0.0000
21 S B 0.0000
22 S B -0.1725
23 L B 0.1806
24 L B 0.0000
25 R B -1.1644
26 T B -0.6257
27 R B -1.8716
28 G B -0.2810
29 C B 0.7535
30 V B 0.2979
31 S B -0.3646
32 E B -1.3742
33 Q B -1.5020
34 R B -0.6440
35 L B 0.0000
36 K B -1.5121
37 V B 0.6607
38 F B 0.0000
39 S B -0.0919
40 G B -0.2173
41 A B -0.0240
42 L B 0.0000
43 Q B -0.6463
44 E B -1.8761
45 A B -0.3283
46 L B 0.0000
47 T B -0.3470
48 E B -1.8898
49 H B -0.7051
50 Y B 0.0000
51 K B -1.8834
52 H B -1.3718
53 H B -0.5449
54 W B 0.0000
55 F B 0.4036
56 P B -0.3143
57 E B -2.0866
58 K B -1.7591
59 P B -0.3772
60 S B -0.4602
61 K B -1.2933
62 G B -0.3259
63 S B -0.1570
64 G B -0.3392
65 Y B 0.6324
66 R B 0.0000
67 C B 0.1352
68 I B 0.0000
69 R B -0.9817
70 I B 0.0000
71 N B -0.9891
72 H B -1.4316
73 K B -1.8852
74 M B 0.0000
75 D B -0.2358
76 P B -0.2566
77 I B 0.1520
78 I B 0.0000
79 S B -0.3981
80 R B -1.8705
81 V B 0.0000
82 A B 0.0000
83 S B -0.6673
84 Q B -1.2354
85 I B 0.0000
86 G B -0.4883
87 L B 0.0000
88 S B -0.3587
89 Q B -1.2690
90 P B -0.6238
91 Q B -1.0210
92 L B 0.0000
93 H B -0.7902
94 Q B -1.3571
95 L B -0.0400
96 L B 0.0000
97 P B -0.0734
98 S B -0.4473
99 E B -1.3664
100 L B 0.0000
101 T B 0.0000
102 L B 0.0000
103 W B 0.2184
104 V B 0.0000
105 D B -0.1836
106 P B 0.0000
107 Y B 0.0544
108 E B -0.9671
109 V B 0.0000
110 S B 0.0000
111 Y B 0.1051
112 R B -0.0503
113 I B 0.7281
114 G B -0.4583
115 E B -2.1603
116 D B -2.1686
117 G B -0.6444
118 S B 0.1060
119 I B 1.9888
120 C B 0.9535
121 V B 1.5033
122 L B 0.8922
123 Y B 0.0119
124 E B -2.2051
125 E B -2.1460
126 A B -0.3202
127 P B -0.2445

 

Laboratory of Theory of Biopolymers 2015