Project name: SH3_L120H

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120H
Energy difference between WT (input) and mutated protein (by FoldX)	1.05225 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4774
• Maximal score value: 1.1296
• Average score: -0.9294
• Total score value: -55.7665

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.7095
91	D	A	-2.8409
92	Y	A	-2.1027
93	E	A	-2.8834
94	S	A	0.0000
95	R	A	-2.7841
96	T	A	-2.1634
97	E	A	-2.3621
98	T	A	-1.3255
99	D	A	-1.4364
100	L	A	0.0000
101	S	A	-1.9144
102	F	A	0.0000
103	K	A	-3.4774
104	K	A	-2.8504
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0701
108	L	A	0.0000
109	Q	A	-0.3038
110	I	A	0.3249
111	V	A	1.1296
112	N	A	-0.5067
113	N	A	-1.8881
114	T	A	-1.7631
115	E	A	-2.9779
116	G	A	-2.5970
117	D	A	-2.6935
118	W	A	-1.4642
119	W	A	-0.9392
120	H	A	-0.0919	mutated: LA120H
121	A	A	0.0000
122	H	A	-0.4848
123	S	A	0.0000
124	L	A	-0.2719
125	T	A	-0.7769
126	T	A	-0.8726
127	G	A	-0.8079
128	Q	A	-1.4023
129	T	A	-0.5963
130	G	A	0.0000
131	Y	A	-0.0709
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3583
135	N	A	-1.2468
136	Y	A	-0.1997
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759