Project name: SH3_L124W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124W
Energy difference between WT (input) and mutated protein (by FoldX)	2.06038 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4405
• Maximal score value: 1.1905
• Average score: -0.8751
• Total score value: -52.5053

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4730
82	S	A	-0.7122
83	H	A	-0.8132
84	M	A	0.2266
85	T	A	-0.1899
86	F	A	-0.0464
87	V	A	-0.5115
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4405
104	K	A	-2.8127
105	G	A	-1.8671
106	E	A	0.0000
107	R	A	-1.6489
108	L	A	0.0000
109	Q	A	-0.3084
110	I	A	0.3743
111	V	A	1.1905
112	N	A	-0.4463
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.7020
120	L	A	0.3705
121	A	A	0.0000
122	H	A	-0.3591
123	S	A	0.0000
124	W	A	0.0760	mutated: LA124W
125	T	A	-0.5184
126	T	A	-0.7397
127	G	A	-0.7269
128	Q	A	-1.3689
129	T	A	-0.4975
130	G	A	0.0000
131	Y	A	0.2140
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0223
139	P	A	-0.1301
140	S	A	-0.1185