Project name: SH3_T129L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA129L
Energy difference between WT (input) and mutated protein (by FoldX)	-0.473117 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.3222
• Average score: -0.8318
• Total score value: -49.9061

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4631
82	S	A	-0.6913
83	H	A	-0.7975
84	M	A	0.2556
85	T	A	0.0000
86	F	A	-0.1187
87	V	A	-0.6297
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1549
97	E	A	-2.3535
98	T	A	-1.0450
99	D	A	-1.1045
100	L	A	0.0000
101	S	A	-1.7153
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0875
108	L	A	0.0000
109	Q	A	-0.1913
110	I	A	0.4942
111	V	A	1.3222
112	N	A	-0.4638
113	N	A	-1.8320
114	T	A	-1.7409
115	E	A	-2.9409
116	G	A	-2.6068
117	D	A	-2.6853
118	W	A	-1.3563
119	W	A	-0.7420
120	L	A	0.5657
121	A	A	0.0000
122	H	A	0.0578
123	S	A	0.0000
124	L	A	-0.1353
125	T	A	-0.7894
126	T	A	-0.7140
127	G	A	-0.5545
128	Q	A	-0.7989
129	L	A	0.7571	mutated: TA129L
130	G	A	0.0000
131	Y	A	0.4339
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2941
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1564
140	S	A	-0.1759