Aggrescan3D: 14eab6839bcdc6 [mutate: DA67T]

Settings

Chain sequence(s)	A: MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	DA67T
Energy difference between WT (input) and mutated protein (by FoldX)	0.0877722 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Drag cursor over the plot to display residue labels.

Show buried residues

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.3147
2	Q	A	-0.3492
3	F	A	-0.7454
4	K	A	-0.5190
5	V	A	0.0000
6	Y	A	-1.3094
7	T	A	-1.6715
8	Y	A	-2.5498
9	K	A	-2.9559
10	R	A	-3.2392
11	E	A	-3.5208
12	S	A	-2.7860
13	R	A	-2.5504
14	Y	A	-1.8963
15	R	A	-2.8030
16	L	A	0.0000
17	F	A	0.0000
18	V	A	0.0000
19	D	A	0.0000
20	V	A	-0.1872
21	Q	A	-0.0412
22	S	A	0.1120
23	D	A	-0.4895
24	I	A	1.5099
25	I	A	1.1057
26	D	A	-1.1189
27	T	A	-1.0336
28	P	A	-0.9049
29	G	A	-0.8221
30	R	A	-1.1945
31	R	A	-0.5240
32	M	A	0.0817
33	V	A	0.0000
34	I	A	0.0000
35	P	A	0.0000
36	L	A	0.0000
37	A	A	0.0000
38	S	A	-0.5339
39	A	A	-0.7546
40	R	A	-1.3024
41	L	A	0.7191
42	L	A	0.2201
43	S	A	-1.0406
44	D	A	-2.6688
45	K	A	-2.5469
46	V	A	-1.4464
47	S	A	-1.8911
48	R	A	-2.9858
49	E	A	-2.6864
50	L	A	-1.2938
51	Y	A	-0.9089
52	P	A	0.0000
53	V	A	-0.6192
54	V	A	0.0000
55	H	A	-1.7014
56	I	A	-1.3520
57	G	A	-1.6565
58	D	A	-2.7226
59	E	A	-2.6604
60	S	A	-1.6835
61	W	A	-0.7830
62	R	A	0.0000
63	M	A	0.0000
64	M	A	0.3526
65	T	A	0.0000
66	T	A	0.4082
67	T	A	0.1154	mutated: DA67T
68	M	A	0.3480
69	A	A	0.1695
70	S	A	-0.0486
71	V	A	0.0000
72	P	A	0.0537
73	V	A	0.7491
74	S	A	-0.0083
75	V	A	-0.8112
76	I	A	-0.6178
77	G	A	-1.6105
78	E	A	-2.5714
79	E	A	-2.1945
80	V	A	-0.5798
81	A	A	-0.8706
82	D	A	-1.3360
83	L	A	0.0000
84	S	A	-1.8151
85	H	A	-2.1386
86	R	A	-2.3593
87	E	A	-3.1256
88	N	A	-3.1603
89	D	A	-3.0994
90	I	A	0.0000
91	K	A	-2.4228
92	N	A	-2.6999
93	A	A	0.0000
94	I	A	-0.0786
95	N	A	0.2406
96	L	A	1.0738
97	M	A	1.5225
98	F	A	2.7740
99	W	A	2.5284
100	G	A	1.9196
101	I	A	2.4465