Project name: SH3_Y136E

Status: done

submitted: 2019-03-14 17:17:43, status changed: 2019-03-14 18:57:26
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues YA136E
Energy difference between WT (input) and mutated protein (by FoldX) 3.36142 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4268
Maximal score value
1.2498
Average score
-0.9042
Total score value
-54.2527

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1387
87 V A -0.6464
88 A A 0.0000
89 L A -0.3220
90 Y A -0.6279
91 D A -2.7911
92 Y A -2.0718
93 E A -2.8618
94 S A 0.0000
95 R A -2.7796
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3218
100 L A 0.0000
101 S A -1.8905
102 F A 0.0000
103 K A -3.4268
104 K A -2.8208
105 G A -1.9287
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6120
117 D A -2.6919
118 W A -1.3851
119 W A -0.7044
120 L A 0.4012
121 A A 0.0000
122 H A -0.3840
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4950
130 G A 0.0000
131 Y A 0.2138
132 I A 0.0000
133 P A -0.6567
134 S A -1.4007
135 N A -1.3877
136 E A 0.0000 mutated: YA136E
137 V A 0.0000
138 A A -0.0864
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015