Project name: SH3_L120F

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120F
Energy difference between WT (input) and mutated protein (by FoldX)	0.206949 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.372
• Average score: -0.876
• Total score value: -52.5624

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4522
82	S	A	-0.6843
83	H	A	-0.7924
84	M	A	0.2647
85	T	A	0.0000
86	F	A	-0.1071
87	V	A	-0.6237
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1632
97	E	A	-2.3618
98	T	A	-1.2321
99	D	A	-1.3206
100	L	A	0.0000
101	S	A	-1.9119
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0748
108	L	A	0.0000
109	Q	A	-0.2143
110	I	A	0.5171
111	V	A	1.3720
112	N	A	-0.2252
113	N	A	-1.7097
114	T	A	-1.6676
115	E	A	-2.8878
116	G	A	-2.5959
117	D	A	-2.6933
118	W	A	-1.2999
119	W	A	-0.5806
120	F	A	0.6351	mutated: LA120F
121	A	A	0.0000
122	H	A	-0.3382
123	S	A	0.0000
124	L	A	-0.2820
125	T	A	-0.7819
126	T	A	-0.8773
127	G	A	-0.8161
128	Q	A	-1.4050
129	T	A	-0.4532
130	G	A	0.0000
131	Y	A	0.2526
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2705
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1516
140	S	A	-0.1759