Project name: 14eab6839bcdc6 [mutate: AA81P]

Chain sequence(s)	A: MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	AA81P
Energy difference between WT (input) and mutated protein (by FoldX)	5.69472 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5233
• Maximal score value: 2.7743
• Average score: -0.813
• Total score value: -82.1127

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.3080
2	Q	A	-0.3571
3	F	A	-0.7704
4	K	A	-0.5662
5	V	A	0.0000
6	Y	A	-1.3396
7	T	A	-1.6864
8	Y	A	-2.5515
9	K	A	-2.9555
10	R	A	-3.2389
11	E	A	-3.5233
12	S	A	-2.7912
13	R	A	-2.5584
14	Y	A	-1.9117
15	R	A	-2.8109
16	L	A	0.0000
17	F	A	0.0000
18	V	A	0.0000
19	D	A	0.0000
20	V	A	-0.1872
21	Q	A	-0.0412
22	S	A	0.1120
23	D	A	-0.4895
24	I	A	1.5099
25	I	A	1.1057
26	D	A	-1.1189
27	T	A	-1.0336
28	P	A	-0.9049
29	G	A	-0.8221
30	R	A	-1.1945
31	R	A	-0.5240
32	M	A	0.0817
33	V	A	0.0000
34	I	A	0.0000
35	P	A	0.0000
36	L	A	0.0000
37	A	A	0.0000
38	S	A	-0.5370
39	A	A	-0.7553
40	R	A	-1.3027
41	L	A	0.7191
42	L	A	0.2199
43	S	A	-1.0406
44	D	A	-2.6688
45	K	A	-2.5469
46	V	A	-1.4464
47	S	A	-1.8911
48	R	A	-2.9871
49	E	A	-2.6885
50	L	A	-1.2938
51	Y	A	-0.9079
52	P	A	0.0000
53	V	A	-0.6198
54	V	A	0.0000
55	H	A	-1.7090
56	I	A	-1.3786
57	G	A	-1.6702
58	D	A	-2.7232
59	E	A	-2.6612
60	S	A	-1.6847
61	W	A	-0.7839
62	R	A	0.0000
63	M	A	0.0000
64	M	A	0.0722
65	T	A	0.0000
66	T	A	-0.0210
67	D	A	-0.7712
68	M	A	-0.0833
69	A	A	-0.0524
70	S	A	-0.0486
71	V	A	0.0000
72	P	A	0.0537
73	V	A	0.7491
74	S	A	-0.0082
75	V	A	-0.8109
76	I	A	-0.6176
77	G	A	-1.6145
78	E	A	-2.5876
79	E	A	-2.2361
80	V	A	-0.6536
81	P	A	-0.9755	mutated: AA81P
82	D	A	-1.4305
83	L	A	0.0000
84	S	A	-1.8400
85	H	A	-2.1495
86	R	A	-2.3681
87	E	A	-3.1279
88	N	A	-3.1648
89	D	A	-3.1093
90	I	A	0.0000
91	K	A	-2.4259
92	N	A	-2.7034
93	A	A	0.0000
94	I	A	-0.0800
95	N	A	0.2409
96	L	A	1.0744
97	M	A	1.5227
98	F	A	2.7743
99	W	A	2.5291
100	G	A	1.9210
101	I	A	2.4472