Project name: HER2.96NT

Status: done

submitted: 2018-10-28 06:29:02, status changed: 2018-11-24 16:04:11
Settings
Chain sequence(s) A: KEIREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLMSLTDDQALAANEELTIKIKCDKEKNMLHITDTGIGMTKEELVKNLGTIAKSGTSEFLSKLTEAQEDGQSTSELIGQFGVGFYSAFLVADRVIVTSKHNNDTQHIWESDSNEFFVTDDPRGDTLGRGSTITLVLKEEATDYLELETVKNLVRKYSQFINFPIYVWSS
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-3.5495
Maximal score value
1.5582
Average score
-0.8957
Total score value
-195.2599

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
689 K A -2.4362
690 E A -2.3825
691 I A -0.6031
692 R A -1.7658
693 E A -2.4477
694 K A -2.3022
695 S A -1.9315
696 E A -2.0234
697 K A -1.7262
698 F A -0.3446
699 A A -0.4447
700 F A -0.5781
701 Q A -1.3002
702 A A -0.9915
703 E A -1.5170
704 V A 0.0000
705 N A 0.0000
706 R A -1.8224
707 M A 0.0000
708 M A 0.0000
709 K A -2.2663
710 L A -1.1449
711 I A 0.0000
712 I A 0.3269
713 N A -1.0048
714 S A -0.4324
715 L A 0.6238
716 Y A 0.4234
717 K A -0.9421
718 N A 0.0000
719 K A 0.0000
720 E A -0.6640
721 I A -0.5489
722 F A 0.0000
723 L A 0.0000
724 R A -0.6473
725 E A 0.0000
726 L A 0.0000
727 I A 0.0000
728 S A -0.3869
729 N A 0.0000
730 A A 0.0000
731 S A 0.0000
732 D A -1.6597
733 A A 0.0000
734 L A 0.0000
735 D A -1.3203
736 K A -0.5699
737 I A 0.0000
738 R A -0.3781
739 L A 0.9204
740 M A 0.2194
741 S A -0.3819
742 L A 0.7007
743 T A -0.4944
744 D A -2.1596
745 D A -2.4854
746 Q A -1.6553
747 A A 0.0000
748 L A -0.2838
749 A A -0.5135
750 A A -0.9968
751 N A -1.8950
752 E A -2.0379
753 E A -2.1277
754 L A -0.5563
755 T A -0.1840
756 I A 0.0000
757 K A 0.2649
758 I A 0.0000
759 K A -0.1046
760 C A 0.0000
761 D A 0.0000
762 K A -3.3026
763 E A -3.5011
764 K A -3.2393
765 N A -2.6146
766 M A -1.1991
767 L A 0.0000
768 H A -0.1655
769 I A 0.0000
770 T A -0.3977
771 D A 0.0000
772 T A 0.0000
773 G A 0.0000
774 I A 0.0000
775 G A 0.0000
776 M A -0.7321
777 T A -1.3531
778 K A 0.0000
779 E A -3.3380
780 E A -3.4686
781 L A 0.0000
782 V A 0.0000
783 K A -3.5130
784 N A -2.7092
785 L A 0.0000
786 G A 0.0000
787 T A -1.8355
788 I A 0.0000
789 A A -1.4420
790 K A -2.2670
791 S A -1.3787
792 G A -0.8420
793 T A 0.0000
794 S A -1.6365
795 E A -1.9162
796 F A 0.0000
797 L A 0.0000
798 S A -1.8226
799 K A -2.5437
800 L A 0.0000
801 T A -2.4636
802 E A -2.4196
803 A A 0.0000
804 Q A -2.9501
805 E A -3.4056
806 D A -3.5118
807 G A -2.3710
808 Q A -2.4930
809 S A 0.0000
810 T A 0.0000
811 S A 0.0000
812 E A -2.1020
813 L A -1.3222
814 I A 0.0000
815 G A -1.4574
816 Q A -1.5193
817 F A -0.2720
818 G A -0.6216
819 V A 0.0000
820 G A 0.0000
821 F A 0.0048
822 Y A 0.0000
823 S A 0.0000
824 A A 0.0000
825 F A 0.0000
826 L A 0.0000
827 V A -0.4634
828 A A 0.0000
829 D A -1.6784
830 R A -1.2839
831 V A 0.0000
832 I A 0.5512
833 V A 0.0000
834 T A 0.2535
835 S A 0.0000
836 K A -1.6679
837 H A 0.0000
838 N A -2.2056
839 N A -2.8184
840 D A -2.6984
841 T A -1.7464
842 Q A -1.3361
843 H A -0.4085
844 I A 0.9194
845 W A 0.0000
846 E A 0.0043
847 S A 0.0000
848 D A -1.2011
849 S A -1.5875
850 N A -2.4717
851 E A -2.3419
852 F A 0.0000
853 F A 0.0000
854 V A -0.2543
855 T A -0.6054
856 D A -1.0833
857 D A -1.3836
858 P A -1.5532
859 R A -2.5137
860 G A -2.1327
861 D A -2.9818
862 T A -1.4321
863 L A -0.2524
864 G A -0.7522
865 R A -1.4982
866 G A -0.6332
867 S A 0.0000
868 T A 0.0251
869 I A 0.0000
870 T A 0.0000
871 L A 0.0000
872 V A -0.5397
873 L A 0.0000
874 K A -3.4675
875 E A -3.5495
876 E A -3.2737
877 A A -2.1250
878 T A -1.2747
879 D A -1.5672
880 Y A 0.0000
881 L A 0.0000
882 E A -2.0788
883 L A -0.7458
884 E A -2.2069
885 T A -2.0038
886 V A 0.0000
887 K A -2.5027
888 N A -2.5818
889 L A 0.0000
890 V A 0.0000
891 R A -3.1882
892 K A -2.9351
893 Y A 0.0000
894 S A -1.5572
895 Q A -1.7751
896 F A 0.2924
897 I A 0.0000
898 N A -0.9791
899 F A -0.1175
900 P A -0.4177
901 I A 0.5877
902 Y A 1.5582
903 V A 0.8948
904 W A 1.1688
905 S A 0.2046
906 S A -0.7457

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.8957 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015