Project name: SH3_W119F

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119F
Energy difference between WT (input) and mutated protein (by FoldX)	4.55697 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2724
• Average score: -0.8831
• Total score value: -52.9889

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4496
82	S	A	-0.6814
83	H	A	-0.7912
84	M	A	0.2842
85	T	A	0.0000
86	F	A	-0.0308
87	V	A	-0.5871
88	A	A	0.0000
89	L	A	-0.3038
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3129
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9534
106	E	A	0.0000
107	R	A	-2.0498
108	L	A	0.0000
109	Q	A	-0.2255
110	I	A	0.4814
111	V	A	1.2724
112	N	A	-0.3899
113	N	A	-1.7796
114	T	A	-1.7159
115	E	A	-2.9161
116	G	A	-2.5923
117	D	A	-2.6671
118	W	A	-1.3022
119	F	A	-0.6097	mutated: WA119F
120	L	A	0.4498
121	A	A	0.0000
122	H	A	-0.3720
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4938
130	G	A	0.0000
131	Y	A	0.2495
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2694
135	N	A	-1.2437
136	Y	A	-0.1990
137	V	A	0.0000
138	A	A	0.0011
139	P	A	-0.1176
140	S	A	-0.1498