Project name: SH3_F86N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	FA86N
Energy difference between WT (input) and mutated protein (by FoldX)	4.78848 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2767
• Average score: -0.9032
• Total score value: -54.1932

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4729
82	S	A	-0.7145
83	H	A	-0.8517
84	M	A	0.1043
85	T	A	0.0000
86	N	A	0.0000	mutated: FA86N
87	V	A	-0.7215
88	A	A	0.0000
89	L	A	-0.3368
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3185
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.1254
108	L	A	0.0000
109	Q	A	-0.3059
110	I	A	0.4275
111	V	A	1.2767
112	N	A	-0.3970
113	N	A	-1.7908
114	T	A	-1.7254
115	E	A	-2.9270
116	G	A	-2.6006
117	D	A	-2.6757
118	W	A	-1.3237
119	W	A	-0.6505
120	L	A	0.4342
121	A	A	0.0000
122	H	A	-0.3701
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4908
130	G	A	0.0000
131	Y	A	0.2372
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2708
135	N	A	-1.2443
136	Y	A	-0.2256
137	V	A	0.0000
138	A	A	-0.0872
139	P	A	-0.2607
140	S	A	-0.2753