Project name: 58083fbfd03a28b

Status: done

submitted: 2019-02-19 05:19:27, status changed: 2019-02-19 07:42:49
Settings
Chain sequence(s) X: PFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-3.7884
Maximal score value
1.9034
Average score
-0.5738
Total score value
-124.5239

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 P X 0.0017
4 F X 0.6136
5 R X -1.1627
6 D X 0.0000
7 C X 0.0000
8 A X 0.0000
9 D X -0.7037
10 V X 0.0000
11 Y X 0.3492
12 Q X -0.7475
13 A X -0.2285
14 G X -0.2614
15 F X 0.0868
16 N X -1.7960
17 K X -2.6940
18 S X -1.2180
19 G X 0.3888
20 I X 1.9034
21 Y X 0.0000
22 T X 0.5975
23 I X 0.4655
24 Y X 0.5296
25 I X -0.5132
26 N X -1.7034
27 N X -1.5874
28 M X -0.5917
29 P X -0.4815
30 E X -0.4074
31 P X 0.0547
32 K X 0.0000
33 K X 0.2347
34 V X 0.0000
35 F X 0.5745
36 C X 0.0000
37 N X -1.5772
38 M X 0.0000
39 D X -1.7779
40 V X 0.2407
41 N X -0.8884
42 G X -1.4482
43 G X 0.0000
44 G X 0.0000
45 W X -0.3348
46 T X 0.0000
47 V X 0.0000
48 I X 0.0000
49 Q X 0.0000
50 H X -0.4400
51 R X 0.0000
52 E X -0.6950
53 D X 0.0000
54 G X -0.8685
55 S X -0.8167
56 L X -0.9242
57 D X -2.0108
58 F X 0.0000
59 Q X -1.6566
60 R X -2.1242
61 G X -2.1681
62 W X 0.0000
63 K X -2.8659
64 E X -1.9910
65 Y X 0.0000
66 K X -0.9243
67 M X 0.1627
68 G X 0.3124
69 F X 1.1067
70 G X 0.2574
71 N X -0.2366
72 P X -0.2850
73 S X -0.5872
74 G X -0.7874
75 E X -0.6517
76 Y X 0.0000
77 W X 0.0000
78 L X 0.0000
79 G X 0.0000
80 N X 0.0000
81 E X -0.2748
82 F X 0.0000
83 I X 0.0000
84 F X 0.3082
85 A X 0.0000
86 I X -0.2783
87 T X 0.0000
88 S X -0.4252
89 Q X -0.8597
90 R X -1.1037
91 Q X -1.2132
92 Y X 0.0000
93 M X -1.0206
94 L X 0.0000
95 R X -0.7830
96 I X 0.0000
97 E X 0.0000
98 L X 0.0000
99 M X -0.8642
100 D X 0.0000
101 W X -0.4198
102 E X -2.0168
103 G X -1.8300
104 N X -2.1773
105 R X -1.6130
106 A X -0.6764
107 Y X -0.3846
108 S X 0.0000
109 Q X -1.2314
110 Y X 0.0000
111 D X -2.4306
112 R X -1.8439
113 F X 0.0000
114 H X -0.9449
115 I X -0.5387
116 G X -1.2100
117 N X -2.8980
118 E X -3.7884
119 K X -3.3519
120 Q X -3.1628
121 N X 0.0000
122 Y X 0.0000
123 R X -1.8116
124 L X 0.0000
125 Y X 0.0660
126 L X 0.0000
127 K X -2.3421
128 G X -1.7245
129 H X -1.6488
130 T X -1.2583
131 G X -1.4042
132 T X -0.9957
133 A X -1.1631
134 G X -1.7011
135 K X -2.5637
136 Q X -2.1606
137 S X -1.2071
138 S X -0.5309
139 L X 0.0000
140 I X 0.0000
141 L X -0.6096
142 H X -1.2130
143 G X -1.0147
144 A X 0.0000
145 D X 0.0000
146 F X 0.0000
147 S X 0.0000
148 T X 0.0000
149 K X -1.8494
150 D X -2.4359
151 A X 0.0000
152 D X -1.5681
153 N X -1.8723
154 D X -1.3399
155 N X -1.1098
156 C X 0.0916
157 M X 0.9407
158 C X 0.3167
159 K X -0.5907
160 C X 0.0000
161 A X 0.0000
162 L X 1.1143
163 M X 1.5479
164 L X 0.7943
165 T X 0.0767
166 G X 0.0000
167 G X 0.0000
168 W X 0.0000
169 W X 0.0000
170 F X 0.0000
171 D X -0.5261
172 A X -0.0428
173 C X 0.6212
174 G X -0.2867
175 P X -0.4537
176 S X 0.0000
177 N X 0.0000
178 L X 0.0000
179 N X 0.0000
180 G X 0.0000
181 M X -0.7835
182 F X 0.0000
183 Y X -1.0012
184 T X -0.8768
185 A X -0.7082
186 G X -1.2022
187 Q X -2.1361
188 N X -2.3291
189 H X -1.9780
190 G X -1.9295
191 K X -2.0198
192 L X -0.0617
193 N X -1.0781
194 G X 0.0000
195 I X 0.0000
196 K X -1.3498
197 W X 0.0000
198 H X -1.2797
199 Y X -1.0096
200 F X 0.0000
201 K X -1.8607
202 G X -1.2673
203 P X -1.2577
204 S X -1.2766
205 Y X 0.0000
206 S X -0.9800
207 L X 0.0000
208 R X -0.3525
209 S X 0.0000
210 T X 0.0000
211 T X 0.0000
212 M X 0.0000
213 M X -0.0251
214 I X 0.0000
215 R X -0.1170
216 P X 0.0000
217 L X 0.2930
218 D X -0.0418
219 F X 1.2693

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.5738 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015