Project name: SH3_S94H

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94H
Energy difference between WT (input) and mutated protein (by FoldX)	4.47919 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.488
• Maximal score value: 1.2501
• Average score: -0.9447
• Total score value: -56.684

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3153
90	Y	A	-0.7427
91	D	A	-2.8630
92	Y	A	-2.1937
93	E	A	-3.0314
94	H	A	-2.4597	mutated: SA94H
95	R	A	-2.9231
96	T	A	-2.2248
97	E	A	-2.3820
98	T	A	-1.2415
99	D	A	-1.3244
100	L	A	0.0000
101	S	A	-1.9907
102	F	A	0.0000
103	K	A	-3.4880
104	K	A	-2.8656
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4193
113	N	A	-1.8135
114	T	A	-1.7325
115	E	A	-2.9357
116	G	A	-2.6079
117	D	A	-2.6831
118	W	A	-1.3280
119	W	A	-0.6849
120	L	A	0.4216
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8770
127	G	A	-0.8169
128	Q	A	-1.4003
129	T	A	-0.4758
130	G	A	0.0000
131	Y	A	0.2264
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2846
135	N	A	-1.2482
136	Y	A	-0.2075
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759