Project name: SH3_L124A

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124A
Energy difference between WT (input) and mutated protein (by FoldX)	1.48464 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1584
• Average score: -0.9706
• Total score value: -58.2375

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4865
82	S	A	-0.7303
83	H	A	-0.8261
84	M	A	0.2034
85	T	A	-0.4635
86	F	A	-0.1844
87	V	A	-0.6634
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2408
99	D	A	-1.3222
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.4033
108	L	A	0.0000
109	Q	A	-0.7462
110	I	A	0.2786
111	V	A	1.1584
112	N	A	-0.4602
113	N	A	-1.8138
114	T	A	-1.7326
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.7017
120	L	A	0.3552
121	A	A	0.0000
122	H	A	-0.7488
123	S	A	0.0000
124	A	A	-1.1968	mutated: LA124A
125	T	A	-1.1964
126	T	A	-1.1327
127	G	A	-1.0953
128	Q	A	-1.5700
129	T	A	-0.6495
130	G	A	0.0000
131	Y	A	0.2146
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2855
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0222
139	P	A	-0.1841
140	S	A	-0.1780