Project name: juliewei2

Status: done

submitted: 2019-04-04 15:27:42, status changed: 2019-04-04 17:53:44
Settings
Chain sequence(s) A: PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Distance of aggregation 5 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-2.2692
Maximal score value
2.183
Average score
-0.3091
Total score value
-63.6644

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
238 P A -0.3170
239 S A -0.0024
240 V A 1.3426
241 F A 2.1830
242 L A 0.8835
243 F A 1.1709
244 P A 0.1027
245 P A -0.3462
246 K A -1.5993
247 P A -0.7896
248 K A -1.7311
249 D A 0.0000
250 T A -0.0099
251 L A 0.0000
252 M A 0.0000
253 I A 1.9736
254 S A -0.1974
255 R A -1.8899
256 T A -0.3669
257 P A -0.1241
258 E A -0.4748
259 V A 0.0000
260 T A -0.0087
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A 0.1316
265 D A 0.0911
266 V A 1.6624
267 S A 0.0117
268 H A -1.1045
269 E A -2.2692
270 D A -2.1511
271 P A -0.7435
272 Q A -0.8942
273 V A -0.1194
274 K A -1.1444
275 F A 0.0000
276 N A -0.1568
277 W A 0.0000
278 Y A 0.4878
279 V A 0.0000
280 D A -1.7332
281 G A -0.4681
282 V A 1.4709
283 Q A -0.2213
284 V A -0.0568
285 H A -0.9729
286 N A -0.3248
287 A A -0.2921
288 K A -1.7018
289 T A -0.4879
290 K A -0.6073
291 P A -0.7114
292 R A -2.2010
293 E A -2.1693
294 Q A -1.3068
295 Q A -1.0948
296 Y A 0.8678
297 N A -1.0753
298 S A -0.4602
299 T A 0.0341
300 Y A 0.2218
301 R A -0.1361
302 V A 0.0000
303 V A 0.2105
304 S A 0.0000
305 V A 0.0000
306 L A 0.0000
307 T A 0.0344
308 V A 0.4275
309 L A 1.1112
310 H A -0.1294
311 Q A -1.4641
312 N A -1.5030
313 W A 0.0000
314 L A -0.1381
315 D A -1.8384
316 G A -0.9741
317 K A -1.3097
318 E A -0.9020
319 Y A 0.0000
320 K A -1.2199
321 C A 0.0000
322 K A -0.7380
323 V A 0.0000
324 S A -0.1002
325 N A -0.5403
326 K A -1.5073
327 A A 0.0799
328 L A 1.5147
329 P A 0.0170
330 A A -0.0978
331 P A -0.2084
332 I A -0.1434
333 E A -1.8398
334 K A 0.0000
335 T A -0.1755
336 I A 0.1492
337 S A -0.2624
338 K A -0.4676
339 A A -0.2001
340 K A -0.9506
341 G A -0.6923
342 Q A -0.4085
343 P A -0.3888
344 R A -0.8740
345 E A -1.9121
346 P A 0.0000
347 Q A -0.4985
348 V A 0.1806
349 Y A 0.5016
350 T A 0.3540
351 L A 1.5288
352 P A 0.1814
353 P A -0.0847
354 S A -0.5269
355 R A -2.0125
356 E A -1.4094
357 E A -1.7878
358 M A 0.5311
359 T A -0.2311
360 K A -1.9601
361 N A -1.7471
362 Q A -1.0259
363 V A 0.0000
364 S A 0.0000
365 L A 0.0000
366 T A 0.0000
367 C A 0.0000
368 L A 0.3811
369 V A 0.0000
370 K A -0.8714
371 G A -0.2976
372 F A 0.0000
373 Y A 0.3718
374 P A -0.1977
375 S A -0.1559
376 D A -0.1210
377 I A 0.4745
378 A A 0.1567
379 V A 0.1457
380 E A -0.4464
381 W A 0.0000
382 E A -0.4813
383 S A 0.0000
384 N A -1.3618
385 G A -0.9250
386 Q A -1.3260
387 P A -0.5049
388 E A -0.5371
389 N A -1.5546
390 N A -1.2589
391 Y A 0.7565
392 K A -1.4611
393 T A -0.3608
394 T A -0.0751
395 P A -0.2774
396 P A 0.1749
397 V A 1.3408
398 L A 1.4498
399 D A -1.4392
400 S A -0.8864
401 D A -1.9164
402 G A -0.8059
403 S A 0.0000
404 F A 0.8686
405 F A 0.6811
406 L A 0.0000
407 Y A 0.3006
408 S A 0.0000
409 K A -0.3912
410 L A 0.0000
411 T A -0.0261
412 V A 0.0000
413 D A -1.2699
414 K A -0.8468
415 S A -0.6515
416 R A -0.3322
417 W A -0.1207
418 Q A -1.4419
419 Q A -1.5033
420 G A -0.8290
421 N A 0.0629
422 V A 1.7160
423 F A 0.0000
424 S A -0.1381
425 C A 0.0000
426 S A 0.0000
427 V A 0.0000
428 M A 0.0000
429 H A 0.0000
430 E A -0.2718
431 A A 0.1908
432 L A 1.3712
433 H A -0.8914
434 N A -1.3776
435 H A -0.5060
436 Y A 0.4372
437 T A 0.0000
438 Q A -1.0095
439 K A -0.5451
440 S A -0.2786
441 L A 0.0000
442 S A 0.0669
443 L A 0.3550

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.3091 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015