Project name: SH3_F86D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	FA86D
Energy difference between WT (input) and mutated protein (by FoldX)	6.58383 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2943
• Average score: -0.8947
• Total score value: -53.682

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4420
82	S	A	-0.6745
83	H	A	-0.7912
84	M	A	0.2330
85	T	A	0.0000
86	D	A	0.0000	mutated: FA86D
87	V	A	-0.7217
88	A	A	0.0000
89	L	A	-0.3369
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3178
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.1220
108	L	A	0.0000
109	Q	A	-0.2649
110	I	A	0.4806
111	V	A	1.2943
112	N	A	-0.3854
113	N	A	-1.7808
114	T	A	-1.7241
115	E	A	-2.9254
116	G	A	-2.5992
117	D	A	-2.6741
118	W	A	-1.3203
119	W	A	-0.6359
120	L	A	0.4466
121	A	A	0.0000
122	H	A	-0.3611
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4873
130	G	A	0.0000
131	Y	A	0.2435
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2654
135	N	A	-1.2437
136	Y	A	-0.2258
137	V	A	0.0000
138	A	A	-0.0879
139	P	A	-0.2326
140	S	A	-0.2496