Project name: SH3_N112K

Status: done

submitted: 2019-03-14 15:26:19, status changed: 2019-03-14 17:15:14
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues NA112K
Energy difference between WT (input) and mutated protein (by FoldX) 0.1951 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
0.328
Average score
-0.9939
Total score value
-59.633

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.5012
82 S A -0.6820
83 H A -0.7908
84 M A 0.2676
85 T A 0.0000
86 F A -0.1034
87 V A -0.6218
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2546
99 D A -1.3397
100 L A 0.0000
101 S A -1.9034
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0707
108 L A 0.0000
109 Q A -0.4900
110 I A -0.0653
111 V A 0.3280
112 K A -1.6340 mutated: NA112K
113 N A -2.4086
114 T A -2.0824
115 E A -3.1181
116 G A -2.7072
117 D A -2.6864
118 W A -1.4991
119 W A -1.1314
120 L A -0.2032
121 A A 0.0000
122 H A -0.6079
123 S A 0.0000
124 L A -0.2789
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.5664
130 G A 0.0000
131 Y A -0.0082
132 I A 0.0000
133 P A 0.0000
134 S A -1.2995
135 N A -1.2490
136 Y A -0.2043
137 V A 0.0000
138 A A -0.0212
139 P A -0.1501
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015