Project name: 5bc7b152d1cd10c

Status: done

submitted: 2019-03-08 11:07:44, status changed: 2019-03-08 11:12:52
Settings
Chain sequence(s) A: LPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSSGRGSVDLHQKVVKVECCVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.2325
Maximal score value
1.5142
Average score
-1.025
Total score value
-106.6049

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 L A 0.5666
7 P A -0.7596
8 N A -1.4972
9 D A -1.5668
10 G A -1.1703
11 G A -1.9188
12 I A 0.0000
13 K A -0.8186
14 L A 0.8852
15 V A 0.0000
16 M A 0.7050
17 A A 0.0000
18 I A -0.5115
19 I A 0.0000
20 R A -1.5905
21 P A -1.5007
22 D A -2.2416
23 K A -2.0647
24 L A -1.3402
25 A A -1.5667
26 D A -2.6429
27 V A 0.0000
28 K A -1.9464
29 T A -1.5807
30 A A -1.8149
31 L A 0.0000
32 A A -1.1562
33 E A -1.7861
34 V A -0.8518
35 G A -0.9662
36 A A -0.7602
37 P A -0.7896
38 S A -0.1068
39 L A 0.2276
40 T A 0.2900
41 V A 0.3036
42 T A -0.4648
43 N A -1.2967
44 V A -0.6295
45 S A -1.3334
46 G A -1.3780
47 R A -2.3112
48 G A -1.8320
49 S A -1.0766
64 V A 0.7171
65 D A -0.9177
66 L A -0.6312
67 H A -1.7127
68 Q A -1.9303
69 K A -1.7706
70 V A 0.0000
71 K A -0.6378
72 V A 0.0000
73 E A 0.2382
74 C A 0.0000
75 V A 0.9714
76 V A 0.0000
77 A A 0.0000
78 D A -2.0005
79 T A -1.2047
80 P A -1.8689
81 A A 0.0000
82 E A -2.9632
83 D A -3.0996
84 V A 0.0000
85 A A -2.1085
86 D A -3.2325
87 A A -2.5453
88 I A 0.0000
89 A A -2.2052
90 D A -2.7997
91 A A -2.1576
92 A A 0.0000
93 H A -2.2479
94 T A -1.9698
95 G A -2.1268
96 E A -3.2227
97 K A -3.0507
98 G A -2.7773
99 D A -2.4024
100 G A -2.3363
101 K A -1.5460
102 I A -0.2240
103 F A 1.2318
104 I A 1.5142
105 L A 1.0778
106 P A -0.2463
107 V A -0.9365
108 E A -2.5585
109 N A -1.8878
110 A A -0.3515
111 I A 1.0112
112 Q A 0.3996
113 V A 0.8756
114 R A -1.1860
115 T A -0.9057
116 G A -0.6385
117 K A -1.5437
118 T A -0.7753
119 G A -1.8586
120 R A -3.0579
121 D A -2.5481
122 A A 0.0000
123 V A -0.1643

 

Laboratory of Theory of Biopolymers 2015