Project name: SH3_T126K

Status: done

submitted: 2019-03-14 15:35:23, status changed: 2019-03-14 18:07:57
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues TA126K
Energy difference between WT (input) and mutated protein (by FoldX) -1.52602 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4617
Maximal score value
1.2498
Average score
-0.9282
Total score value
-55.6926

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6112
88 A A 0.0000
89 L A -0.2960
90 Y A -0.7106
91 D A -2.8014
92 Y A -2.0680
93 E A -2.8514
94 S A 0.0000
95 R A -2.7784
96 T A -2.1500
97 E A -2.3526
98 T A -1.2375
99 D A -1.3093
100 L A 0.0000
101 S A -1.9263
102 F A 0.0000
103 K A -3.4617
104 K A -2.8110
105 G A -1.9352
106 E A 0.0000
107 R A -2.1693
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6978
120 L A 0.4047
121 A A 0.0000
122 H A -0.4869
123 S A 0.0000
124 L A -0.5157
125 T A -1.1531
126 K A -1.6599 mutated: TA126K
127 G A -1.1883
128 Q A -1.6220
129 T A -0.5795
130 G A 0.0000
131 Y A 0.2246
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015