Project name: SH3_S134P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134P
Energy difference between WT (input) and mutated protein (by FoldX)	0.487348 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5127
• Maximal score value: 1.2521
• Average score: -0.902
• Total score value: -54.1183

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4505
82	S	A	-0.6822
83	H	A	-0.7912
84	M	A	0.2683
85	T	A	0.0000
86	F	A	-0.0990
87	V	A	-0.6336
88	A	A	0.0000
89	L	A	-0.3664
90	Y	A	-0.8500
91	D	A	-2.9082
92	Y	A	-2.1332
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3226
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.5127
104	K	A	-2.9092
105	G	A	-1.9823
106	E	A	0.0000
107	R	A	-2.0698
108	L	A	0.0000
109	Q	A	-0.2462
110	I	A	0.4408
111	V	A	1.2521
112	N	A	-0.4181
113	N	A	-1.8142
114	T	A	-1.7322
115	E	A	-2.9372
116	G	A	-2.6107
117	D	A	-2.6881
118	W	A	-1.3451
119	W	A	-0.6979
120	L	A	0.4054
121	A	A	0.0000
122	H	A	-0.3828
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4946
130	G	A	0.0000
131	Y	A	0.2193
132	I	A	0.0000
133	P	A	0.0000
134	P	A	-1.2970	mutated: SA134P
135	N	A	-1.2661
136	Y	A	-0.2360
137	V	A	0.0000
138	A	A	-0.0213
139	P	A	-0.1482
140	S	A	-0.1743