Project name: 5ca26aa7fc3eade [mutate: PA112H, DA169G, NA267S]

Status: done

submitted: 2018-11-07 11:06:18, status changed: 2018-11-07 11:16:15
Settings
Chain sequence(s) A: KTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues PA112H, DA169G, NA267S
Energy difference between WT (input) and mutated protein (by FoldX) 2.20389 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.6235
Maximal score value
0.6707
Average score
-1.0918
Total score value
-183.4171

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
102 K A -2.6141
103 T A -1.7211
104 S A 0.0000
105 D A 0.0000
106 L A 0.0000
107 I A 0.0000
108 V A 0.0000
109 L A 0.0000
110 G A 0.0000
111 L A 0.0000
112 H A -1.4351 mutated: PA112H
113 W A -1.0252
114 K A -1.9440
115 T A -1.6158
116 T A -1.4309
117 E A -1.8941
118 Q A -2.4834
119 D A -2.4101
120 L A 0.0000
121 K A -2.3603
122 E A -2.7466
123 Y A -1.1980
124 F A 0.0000
125 S A -1.1473
126 T A -0.5939
127 F A -0.4419
128 G A -1.2618
129 E A -1.8180
130 V A 0.0000
131 L A 0.6707
132 M A 0.0000
133 V A 0.0000
134 Q A -0.7127
135 V A -0.5641
136 K A -0.8441
137 K A -1.5517
138 D A -1.1486
139 L A -0.2041
140 K A -1.4261
141 T A -1.2120
142 G A -1.1691
143 H A -1.7470
144 S A -1.2589
145 K A -1.1243
146 G A 0.0000
147 F A 0.0000
148 G A 0.0000
149 F A 0.0000
150 V A 0.0000
151 R A -0.2577
152 F A 0.0000
153 T A -1.1997
154 E A -2.4641
155 Y A -1.7676
156 E A -2.1753
157 T A 0.0000
158 Q A 0.0000
159 V A -0.7295
160 K A -1.0239
161 V A 0.0000
162 M A -0.8441
163 S A -1.2087
164 Q A -2.2125
165 R A -2.1150
166 H A 0.0000
167 M A 0.1932
168 I A 0.0000
169 G A -1.1292 mutated: DA169G
170 G A -0.7951
171 R A -0.6677
172 W A 0.2480
173 C A 0.0000
174 D A -0.9024
175 C A 0.0000
176 K A -1.2539
177 L A -0.5645
178 P A 0.0000
179 N A -1.5632
180 S A -1.0898
181 K A 0.0000
182 Q A -2.0021
183 S A -1.8725
184 Q A -2.8518
185 D A -3.4852
186 E A -2.8206
187 P A -1.4543
188 L A -0.4891
189 R A -2.6530
190 S A -3.0575
191 R A -2.8919
192 K A -2.1988
193 V A 0.0000
194 F A -0.2152
195 V A 0.0000
196 G A 0.0000
197 R A -0.4130
198 C A 0.0000
199 T A -1.4059
200 E A -2.5271
201 D A -3.0291
202 M A 0.0000
203 T A -1.9051
204 E A -2.0250
205 D A -3.2482
206 E A -3.0355
207 L A 0.0000
208 R A -3.0567
209 E A -3.2680
210 F A -1.8761
211 F A 0.0000
212 S A -1.6230
213 Q A -1.6852
214 Y A -0.4521
215 G A -1.2935
216 D A -1.9551
217 V A 0.0000
218 M A -0.7398
219 D A -1.8460
220 V A -1.1802
221 F A -0.0406
222 I A 0.0000
223 P A 0.0000
224 K A -1.7006
225 P A -1.3880
226 F A -0.9152
227 R A -0.8763
228 A A 0.0000
229 F A 0.0000
230 A A 0.0000
231 F A 0.0000
232 V A 0.0000
233 T A -1.2236
234 F A 0.0000
235 A A -1.5708
236 D A -2.4951
237 D A -3.6235
238 Q A -2.9727
239 I A -1.9443
240 A A 0.0000
241 Q A -2.3990
242 S A -1.4634
243 L A 0.0000
244 C A 0.0000
245 G A -1.8719
246 E A -2.0929
247 D A 0.0000
248 L A 0.0000
249 I A -0.1839
250 I A 0.0000
251 K A -2.0210
252 G A -0.9175
253 I A 0.0000
254 S A 0.0000
255 V A 0.0000
256 H A -0.5033
257 I A 0.0000
258 S A -0.7034
259 N A -1.3608
260 A A 0.0000
261 E A -2.6513
262 P A -2.4447
263 K A -2.5796
264 H A -2.3964
265 N A -2.7528
266 S A -2.2276
267 S A -2.2911 mutated: NA267S
268 R A -2.8814
269 Q A -2.4115

 

Laboratory of Theory of Biopolymers 2015