Project name: SH3_T114N

Status: done

submitted: 2019-03-14 15:27:57, status changed: 2019-03-14 17:24:30
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues TA114N
Energy difference between WT (input) and mutated protein (by FoldX) 0.192781 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4904
Maximal score value
1.1842
Average score
-0.9521
Total score value
-57.1252

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1605
97 E A -2.3591
98 T A -1.2553
99 D A -1.3463
100 L A 0.0000
101 S A -1.9115
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2285
110 I A 0.4780
111 V A 1.1842
112 N A -0.6210
113 N A -2.3292
114 N A -2.8866 mutated: TA114N
115 E A -3.4904
116 G A -2.8766
117 D A -2.8346
118 W A -1.5028
119 W A -0.8947
120 L A 0.2957
121 A A 0.0000
122 H A -0.3729
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.5047
130 G A 0.0000
131 Y A 0.1867
132 I A 0.0000
133 P A 0.0000
134 S A -1.2921
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015