Project name: 5d93bf193dcdf1f

Status: done

submitted: 2019-03-20 17:12:44, status changed: 2019-03-20 17:33:14
Settings
Chain sequence(s) A: EFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLE
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.8734
Maximal score value
1.4813
Average score
-0.6462
Total score value
-50.4068

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
22 E A -1.2847
23 F A 0.0004
24 V A 1.0111
25 E A -0.5999
26 E A -0.6408
27 F A 0.6807
28 N A -0.2843
29 R A 0.0000
30 L A -0.2531
31 K A -1.0551
32 T A -0.5590
33 F A 0.0000
34 A A -0.9023
35 N A -1.5358
36 F A -1.0954
37 P A -1.0631
38 S A -0.7341
39 G A -0.6806
40 S A -0.7861
41 P A -0.6053
42 V A 0.0000
43 S A -0.5148
44 A A -0.6502
45 S A -0.6165
46 T A -0.5700
47 L A 0.0000
48 A A 0.0000
49 R A -1.6223
50 A A 0.0000
51 G A 0.0000
52 F A 0.0000
53 L A -0.5953
54 Y A -0.8829
55 T A -1.0748
56 G A -1.6778
57 E A -2.6048
58 G A -2.1965
59 D A -1.9890
60 T A -1.9089
61 V A 0.0000
62 R A -1.3176
63 C A 0.0000
64 F A -0.0002
65 S A 0.0231
66 C A -0.9136
67 H A -1.1282
68 A A -0.6322
69 A A -0.7015
70 V A 0.0000
71 D A -2.6663
72 R A -2.8734
73 W A 0.0000
74 Q A -1.4755
75 Y A 0.2756
76 G A -0.4409
77 D A -0.8501
78 S A -0.3154
79 A A 0.0000
80 V A 0.4456
81 G A -0.4001
82 R A -0.9713
83 H A 0.0000
84 R A -2.0102
85 K A -1.9905
86 V A -0.5289
87 S A -1.2927
88 P A -1.9322
89 N A -2.2716
90 C A 0.0000
91 R A -1.6186
92 F A 0.2372
93 I A -0.4987
94 N A -1.3150
95 G A 0.3737
96 F A 1.4666
97 Y A 1.4161
98 L A 1.4813
99 E A -0.6901

 

Laboratory of Theory of Biopolymers 2015