Project name: 3I40

Status: done

submitted: 2021-09-20 03:00:19, status changed: 2021-09-20 03:06:25
Settings
Chain sequence(s) A: GIVEQCCTSICSLYQLENYCN
B: FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.5554
Maximal score value
1.7407
Average score
-0.4056
Total score value
-20.6839

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -1.2750
2 I A 0.0000
3 V A -0.9140
4 E A -1.9139
5 Q A -1.1799
6 C A 0.0000
7 C A -0.5975
8 T A -0.4879
9 S A -0.1069
10 I A 0.5939
11 C A 0.0000
12 S A 0.4097
13 L A 0.9285
14 Y A 0.8030
15 Q A -0.6169
16 L A 0.0000
17 E A -1.3529
18 N A -1.6081
19 Y A 0.0000
20 C A -1.3288
21 N A -1.9698
1 F B 1.5723
2 V B 0.6206
3 N B -0.5726
4 Q B -0.7609
5 H B -0.7690
6 L B 0.0000
7 C B -0.8317
8 G B -0.7624
9 S B -1.1840
10 H B -1.3968
11 L B 0.0000
12 V B -0.0542
13 E B -1.1309
14 A B 0.0000
15 L B 0.0000
16 Y B 1.1350
17 L B 1.7407
18 V B 0.8437
19 C B 0.0000
20 G B -1.0072
21 E B -2.4547
22 R B -2.5554
23 G B -0.9743
24 F B -0.0763
25 F B 1.3266
26 Y B 0.9217
27 T B -0.0605
28 P B -0.9240
29 K B -1.8875
30 A B -0.8256

 

Laboratory of Theory of Biopolymers 2015