Project name: 5df258799146518

Status: done

submitted: 2021-08-21 15:39:01, status changed: 2021-08-21 15:43:16
Settings
Chain sequence(s) A: GKTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHRFDAWYGWKNHCQGSLPDISSC
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.7911
Maximal score value
0.0916
Average score
-1.2165
Total score value
-145.9837

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -1.9716
2 K A -2.1244
3 T A -1.2881
4 F A 0.0000
5 T A -0.5049
6 R A -0.9072
7 C A -0.0122
8 G A -0.5696
9 L A 0.0000
10 V A 0.0000
11 H A -1.8523
12 E A -2.0110
13 L A 0.0000
14 R A -2.8393
15 K A -2.7504
16 H A -2.0965
17 G A -1.9894
18 F A 0.0000
19 E A -2.6357
20 E A -3.2022
21 N A -2.5016
22 L A -1.7955
23 M A 0.0000
24 R A -1.8913
25 N A -1.1739
26 W A 0.0000
27 V A 0.0000
28 C A 0.0000
29 L A 0.0000
30 V A 0.0000
31 E A -1.0416
32 H A -1.0371
33 E A -0.7938
34 S A 0.0000
35 S A -0.9594
36 R A -1.2157
37 D A -1.3994
38 T A 0.0000
39 S A -1.2246
40 K A -1.3132
41 T A -1.0972
42 N A -1.5361
43 T A -1.7107
44 N A -2.2804
45 R A -2.8565
46 N A -2.7036
47 G A -2.0437
48 S A 0.0000
49 K A -2.1139
50 D A -1.3633
51 Y A 0.0000
52 G A 0.0000
53 L A 0.0000
54 F A 0.0000
55 Q A 0.0000
56 I A 0.0000
57 N A 0.0000
58 D A -1.7425
59 R A -1.7958
60 Y A -0.3092
61 W A -1.0671
62 C A 0.0000
63 S A 0.0000
64 K A -2.6706
65 G A -1.5493
66 A A -0.8497
67 S A -1.1933
68 P A -1.8477
69 G A -2.0484
70 K A -2.5675
71 D A -2.5882
72 C A -2.0576
73 N A -2.3401
74 V A 0.0000
75 K A -1.7052
76 C A 0.0000
77 S A -1.0143
78 D A -1.3333
79 L A 0.0000
80 L A -1.0637
81 T A -1.6629
82 D A -2.8099
83 D A -2.1965
84 I A 0.0000
85 T A -1.6100
86 K A -1.5831
87 A A 0.0000
88 A A 0.0000
89 K A -2.0165
90 C A 0.0000
91 A A 0.0000
92 K A -2.3404
93 K A -2.5566
94 I A 0.0000
95 Y A -3.1322
96 K A -3.4559
97 R A -3.7911
98 H A -3.5981
99 R A -3.5597
100 F A 0.0000
101 D A -2.4586
102 A A -1.3716
103 W A 0.0000
104 Y A 0.0916
105 G A 0.0000
106 W A -1.3375
107 K A -2.2237
108 N A -2.0695
109 H A -1.7426
110 C A 0.0000
111 Q A -2.1469
112 G A -1.4849
113 S A -0.9322
114 L A -0.6366
115 P A -1.0077
116 D A -1.8793
117 I A -1.1263
118 S A -0.5859
119 S A -0.2573
120 C A 0.0490

 

Laboratory of Theory of Biopolymers 2015