Project name: SH3_L120W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120W
Energy difference between WT (input) and mutated protein (by FoldX)	1.71192 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.4378
• Average score: -0.8687
• Total score value: -52.1244

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4506
82	S	A	-0.6820
83	H	A	-0.7908
84	M	A	0.2676
85	T	A	0.0000
86	F	A	-0.1034
87	V	A	-0.6218
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1733
97	E	A	-2.3720
98	T	A	-1.2454
99	D	A	-1.3467
100	L	A	0.0000
101	S	A	-1.9258
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0707
108	L	A	0.0000
109	Q	A	-0.1749
110	I	A	0.5633
111	V	A	1.4378
112	N	A	-0.1164
113	N	A	-1.6567
114	T	A	-1.6309
115	E	A	-2.8619
116	G	A	-2.5875
117	D	A	-2.7031
118	W	A	-1.2934
119	W	A	-0.5391
120	W	A	0.7220	mutated: LA120W
121	A	A	0.0000
122	H	A	-0.3133
123	S	A	0.0000
124	L	A	-0.2781
125	T	A	-0.7809
126	T	A	-0.8774
127	G	A	-0.8163
128	Q	A	-1.4070
129	T	A	-0.4566
130	G	A	0.0000
131	Y	A	0.2121
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2714
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1501
140	S	A	-0.1759