Project name: SH3_Y90D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA90D
Energy difference between WT (input) and mutated protein (by FoldX)	1.33566 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -4.1832
• Maximal score value: 1.2498
• Average score: -1.0443
• Total score value: -62.6609

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0535
87	V	A	-0.8643
88	A	A	0.0000
89	L	A	-1.4009
90	D	A	-3.4635	mutated: YA90D
91	D	A	-4.1832
92	Y	A	-2.7726
93	E	A	-2.8754
94	S	A	0.0000
95	R	A	-2.7841
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3233
100	L	A	0.0000
101	S	A	-1.8939
102	F	A	0.0000
103	K	A	-4.1144
104	K	A	-3.9410
105	G	A	-2.3920
106	E	A	0.0000
107	R	A	-2.0566
108	L	A	0.0000
109	Q	A	-0.2458
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9362
116	G	A	-2.6084
117	D	A	-2.6844
118	W	A	-1.3401
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7744
126	T	A	-0.8723
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2781
135	N	A	-1.5202
136	Y	A	-0.8792
137	V	A	0.0000
138	A	A	0.0548
139	P	A	-0.1430
140	S	A	-0.1681